SecReT4
Protein ID: 170745037
T4SS name [ID]VirB [374]
Gene symbol-
Locus tagMrad2831_6330
StrainMethylobacterium radiotolerans JCM 2831
Repliconplasmid pMRAD02 [GenBank: NC_010509] [Browse all T4SS(s) in this replicon]
Location [Strand]27359..28114 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB1M9S7
KEGG IDmrd:Mrad2831_6330
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-65, Aligned region: 39..244
Protein Sequence: 251 a.a.     [Download]
>gi|170745037|ref|YP_001766495.1| VirB8 family protein [Methylobacterium radiotolerans JCM 2831]
MFGRNKRPKVHSTMRQTGNATIIDVTPEDSPYYEQVIGWEASRTLALEKSERRAWRVAGAFGVAFVLVAI
GIAVMAPLKESIPYVIRVDSATGVPDLVTALDSKGVGYDEAMDRYWLAQFVRARETYDWYTLQKDYDTVG
LLSAPNVAKQYGELFTGDNALDKKFGSQIRATVEIVSVVPNGDGVGTVRFIKTTKRAEETGRGQVTRWIA
TIAYKYQNPSVLKESARLTNPLGFQVTSYRADPELTTEGTR
 
Nucleotide Sequence: 756 bp     [Download]
>gi|170745005|ref|NC_010509.1|:27359-28114 Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence
ATGTTCGGACGCAATAAGCGCCCCAAGGTGCATTCCACGATGAGGCAAACTGGCAACGCGACGATCATCG
ACGTCACGCCAGAGGATAGCCCGTACTACGAACAGGTGATCGGCTGGGAAGCTTCCCGCACCCTCGCCCT
GGAAAAGTCCGAGCGGCGCGCCTGGCGCGTCGCTGGCGCGTTCGGCGTCGCCTTCGTTCTGGTGGCGATC
GGCATTGCCGTCATGGCGCCGCTGAAGGAGAGCATTCCCTACGTCATCCGCGTGGACAGCGCGACCGGCG
TGCCGGATCTCGTCACTGCGCTCGACAGCAAGGGTGTGGGATACGACGAGGCGATGGACCGGTATTGGCT
GGCCCAGTTCGTGCGCGCCCGTGAGACCTACGACTGGTACACCCTGCAAAAGGACTACGACACTGTAGGC
CTGCTGTCGGCGCCGAATGTCGCCAAGCAATACGGCGAGCTTTTCACCGGCGACAATGCGCTGGACAAGA
AGTTCGGATCGCAGATCCGTGCGACGGTTGAGATCGTCAGCGTCGTTCCCAACGGAGACGGGGTCGGTAC
GGTCCGTTTCATCAAGACGACGAAGCGCGCCGAGGAAACCGGCCGTGGGCAAGTCACGCGTTGGATCGCG
ACGATCGCCTACAAGTACCAGAACCCATCGGTCCTGAAAGAGTCGGCGCGGCTGACTAACCCCCTCGGCT
TCCAGGTCACGAGCTATCGCGCCGACCCGGAGCTGACGACGGAGGGCACGCGATGA
 Primer design