SecReT4
Protein ID: 170745040
T4SS name [ID]VirB [374]
Gene symbol-
Locus tagMrad2831_6333
StrainMethylobacterium radiotolerans JCM 2831
Repliconplasmid pMRAD02 [GenBank: NC_010509] [Browse all T4SS(s) in this replicon]
Location [Strand]30115..31188 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB1M9T0
KEGG IDmrd:Mrad2831_6333
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.5e-63, Aligned region: 25..328
Protein Sequence: 357 a.a.     [Download]
>gi|170745040|ref|YP_001766498.1| P-type DNA transfer ATPase VirB11 [Methylobacterium radiotolerans JCM 2831]
MSRPVEIATVGVGFNRASSVRHLMEPLSPWMGDSSITEICVNRPGEVFIERESRWECYEEPGLTYAHLES
LGTAIARYGNDTLDDVKPILSGILPDGERVQIVRPDACEHGTFSYTIRKPSFSRRSLEDYNRQGFFKHIR
PVSTGLTSAERELLELRSTGDTLGFLRRAVQLDKVIVVAGETGSGKTTFMKALMQEIPREQRLITIEDTP
ELFLPDHPNHVHLFYKSEAKEEDGAIVTPASLLKSCLRMKPTRILLAELRSGETYDFLNVAASGHGGSIT
SVHAGSCDLAFERLALMVLQNRQGRQLPYPVIRRLLHLVVDVVVHITNDTDEGGFGRHITELWYDPDAKR
ALGKIDA
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|170745005|ref|NC_010509.1|:30115-31188 Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence
ATGTCCAGACCCGTTGAAATCGCGACCGTTGGCGTGGGCTTTAATCGAGCGTCCTCGGTGCGGCACTTGA
TGGAGCCGCTTAGCCCATGGATGGGCGATAGCTCCATTACCGAGATATGCGTCAATCGGCCGGGCGAGGT
CTTCATCGAGCGCGAAAGTCGCTGGGAGTGTTACGAAGAACCTGGGCTGACGTATGCACACCTGGAGTCG
CTTGGCACGGCTATTGCCAGGTACGGCAACGACACGCTGGACGATGTCAAGCCGATCCTGTCGGGCATCC
TTCCCGATGGCGAGCGTGTGCAGATTGTGCGGCCGGATGCCTGCGAACACGGCACGTTCTCCTACACGAT
CCGCAAGCCATCGTTCAGTCGGCGCAGCCTGGAGGACTACAACCGCCAGGGCTTTTTCAAGCACATCAGA
CCGGTATCAACCGGCCTGACGAGTGCAGAGCGCGAGCTGCTGGAGCTGCGCTCGACCGGCGACACGCTCG
GCTTCCTCCGGCGTGCAGTCCAGTTGGACAAAGTGATCGTCGTCGCCGGCGAGACCGGCTCGGGCAAGAC
GACGTTCATGAAGGCATTGATGCAGGAAATTCCTCGCGAGCAACGCCTGATTACGATCGAGGACACGCCC
GAGCTGTTTCTGCCAGACCACCCGAACCACGTGCATCTGTTCTACAAGAGCGAGGCGAAGGAAGAAGATG
GCGCGATCGTCACCCCGGCGTCGCTGCTGAAGAGCTGCCTTCGCATGAAGCCGACGCGCATCCTCCTGGC
GGAGCTGCGCAGCGGCGAAACATACGACTTCCTCAACGTCGCGGCCTCGGGTCACGGTGGCAGCATTACG
AGCGTGCACGCGGGGTCGTGCGACCTGGCCTTTGAACGGCTGGCCTTGATGGTTCTGCAGAACCGCCAGG
GCCGCCAGTTGCCCTATCCGGTGATCCGCCGGCTGCTGCACCTGGTGGTCGATGTCGTGGTGCATATCAC
CAACGACACCGACGAAGGCGGCTTTGGCCGGCATATCACCGAGCTTTGGTACGACCCCGATGCCAAGCGA
GCGCTTGGCAAGATCGACGCGTGA
 Primer design