SecReT4
Protein ID: 170745041
T4SS name [ID]VirB [374]
Gene symbol-
Locus tagMrad2831_6334
StrainMethylobacterium radiotolerans JCM 2831
Repliconplasmid pMRAD02 [GenBank: NC_010509] [Browse all T4SS(s) in this replicon]
Location [Strand]31391..34084 [+]
ProductTRAG family protein
Component typeVirD4
UniProt IDB1M9T1
KEGG IDmrd:Mrad2831_6334
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-100, Aligned region: 101..256
T4SS-DNA_transf [PF02534], Evalue: 1.1e-100, Aligned region: 378..630
TraG-D_C [PF12696], Evalue: 2.3e-23, Aligned region: 473..595
TrwB_AAD_bind [PF10412], Evalue: 1.5e-15, Aligned region: 387..606
Ribosomal_L12 [PF00542], Evalue: 2.3e-07, Aligned region: 291..354
Protein Sequence: 897 a.a.     [Download]
>gi|170745041|ref|YP_001766499.1| TRAG family protein [Methylobacterium radiotolerans JCM 2831]
MSGEKWAKLVFVLVVLIVGTAGVVYLGGVMFYLLGKANPIGKTDFGTWWTYWSYYKNNPPVAKRLIWALV
IPAVPIYGAIIAATIAAMRDQRKLYGESRFANEGEIAAAGLFAPKGIIVGKWKKRFLLFPGLQFVLLSAP
TRSGKGVGIVIPNLLSWEDSVVVLDVKQENFLVTSGWRARYGHACYLFNPFAEDGRTHRYNPLGYISDDP
RLRVGEILDLGYAIYPGDGKEPFFDDTARNLFLGLVLYLIETPELPRTFGELLRQASGKGKSAKDHIQGI
ITSRNYREFGDIMLNSAGEDQAQTVKVIMDLKRVDKREAEALCDEIPFAVAENVPAADIEAIEQQLKACG
AEYETERRLEPIVQWDGVGLPPLSSECVDALNRFVTTSDNTLSSIMSTFNSPLTLWASPIFDAATAANDF
DLREVRRKRMSVYIGIPAAKLDSARLIMNMMFSQLVKLNLDVQLNATPDVKYHCMMLMDEFTAPGRIGII
AKSNAYMASYGMRLVTIIQSAGQLEADIPMGYGRDLARTLVTNHACQIFYTPREQRDANDYSEALGYYTF
KSTGRSRQLGRSGGSESESDQKRPLMMPQELKEMSQREQIINLENTKAIKCTKIRYYEDYVFLDRLAEVD
PSLLTRNFLGMRRKPTQRELERSWGGWKLAAPVPTIDFDLHDAIVQSRVREVTPDDIAGGIDLRKLAMDT
SKIRDLAAGQELPPEQVKGIVADFFDALEAASPSSAGDIGEEDAVSDEELARLDAEAATETDDDDDGDRA
TDAAEPPVAPAAAIAPIVVKAVAQPEPPAEPPASDTVGEPADEDDATEAGAEDGGDAEGDDVPELSEDDE
ARLYDDLPDLSDFDADTEVVHPDDEVLEDDDAAPTPATAPHKPILDLSILDRPIDRK
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|170745005|ref|NC_010509.1|:31391-34084 Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence
ATGAGCGGTGAGAAGTGGGCAAAGCTTGTCTTTGTCCTTGTGGTTTTGATCGTAGGTACTGCCGGCGTCG
TCTACCTGGGCGGCGTCATGTTCTACCTGCTCGGCAAAGCAAATCCGATCGGCAAGACGGATTTCGGCAC
CTGGTGGACCTATTGGAGCTACTACAAGAACAATCCGCCGGTGGCGAAGCGCCTGATTTGGGCGCTGGTG
ATCCCGGCAGTTCCGATCTATGGCGCCATCATCGCAGCCACGATCGCGGCGATGCGCGACCAGCGCAAGC
TCTACGGAGAGTCGCGGTTCGCCAACGAGGGCGAGATCGCGGCCGCAGGCCTGTTTGCGCCGAAGGGCAT
CATCGTCGGCAAGTGGAAGAAGCGGTTCCTTCTCTTTCCCGGCCTGCAATTCGTGCTGCTGTCGGCGCCG
ACGCGATCCGGCAAGGGCGTCGGCATCGTGATCCCGAACCTGCTGAGCTGGGAGGACTCTGTGGTCGTCC
TCGACGTGAAGCAAGAGAACTTCCTGGTCACCTCGGGTTGGCGCGCCCGATACGGGCACGCCTGCTACTT
GTTCAATCCGTTCGCGGAGGATGGTCGAACCCACCGCTACAACCCACTGGGCTATATCAGTGACGACCCG
CGTTTGCGCGTCGGCGAGATCCTGGACCTGGGATATGCGATCTATCCTGGCGACGGCAAAGAACCATTCT
TCGACGACACAGCGCGCAACCTGTTCCTAGGGCTGGTTCTGTACTTGATTGAAACACCCGAATTGCCGCG
CACATTCGGCGAATTGCTGCGCCAGGCCTCGGGCAAGGGCAAGTCGGCCAAAGACCACATCCAGGGAATC
ATCACATCCCGCAATTACCGCGAGTTCGGCGACATCATGCTCAACAGCGCCGGCGAGGACCAGGCGCAGA
CGGTGAAGGTCATCATGGACCTGAAGCGTGTGGACAAGCGCGAGGCGGAGGCACTTTGCGATGAGATCCC
GTTTGCAGTCGCCGAGAACGTGCCGGCCGCTGACATCGAGGCGATCGAACAGCAATTGAAGGCGTGCGGC
GCCGAGTACGAGACGGAACGGCGTCTTGAGCCAATCGTGCAATGGGACGGGGTAGGCCTGCCGCCGCTGT
CGTCGGAGTGCGTAGACGCGCTGAACCGGTTCGTGACGACTTCCGACAACACGTTGTCGAGCATCATGTC
CACGTTCAACTCGCCTTTGACGCTGTGGGCTAGTCCGATTTTCGACGCGGCGACAGCAGCGAACGATTTC
GATCTACGCGAGGTGCGCCGCAAGAGGATGTCGGTCTACATCGGTATTCCTGCCGCCAAGCTCGATAGCG
CGCGGCTCATCATGAACATGATGTTTTCGCAGCTCGTTAAGCTGAACCTGGACGTGCAGCTCAACGCGAC
GCCAGACGTGAAATATCACTGCATGATGCTCATGGACGAGTTCACCGCTCCGGGCCGCATCGGCATCATT
GCGAAGTCCAACGCGTACATGGCGAGCTATGGGATGCGGCTGGTGACCATCATTCAATCCGCCGGCCAGT
TGGAAGCGGACATCCCAATGGGATACGGCCGCGACCTGGCGCGGACACTTGTCACGAACCACGCGTGTCA
GATTTTCTACACACCGCGCGAACAGCGCGACGCGAACGATTATTCGGAAGCGCTCGGGTACTACACCTTC
AAGTCAACCGGCCGCAGTCGGCAGCTCGGCCGTTCTGGCGGCTCCGAGTCGGAGTCCGACCAGAAACGGC
CGTTGATGATGCCGCAAGAGCTGAAGGAAATGAGTCAGCGCGAGCAAATCATCAACCTGGAGAACACGAA
GGCGATCAAGTGCACGAAGATCCGGTACTACGAGGATTACGTGTTCCTGGACCGGCTGGCGGAAGTAGAT
CCATCGCTACTCACACGCAACTTCCTGGGGATGCGGCGTAAGCCGACACAGCGCGAGTTGGAACGATCGT
GGGGCGGCTGGAAGCTCGCGGCGCCCGTGCCGACCATCGATTTCGATTTGCACGATGCCATCGTGCAGAG
CCGCGTGCGTGAGGTAACGCCGGATGACATCGCCGGCGGTATCGACCTGCGCAAGCTGGCAATGGACACG
TCGAAGATCCGCGACCTGGCCGCAGGCCAGGAGCTGCCGCCCGAACAGGTGAAGGGGATCGTCGCCGACT
TCTTCGACGCGCTGGAAGCGGCGTCGCCGTCCTCGGCAGGGGACATTGGCGAAGAGGATGCGGTCAGCGA
CGAGGAGTTGGCCCGGCTCGATGCGGAGGCGGCGACGGAGACCGACGACGACGACGATGGTGATCGCGCG
ACCGATGCAGCCGAGCCGCCGGTGGCGCCAGCGGCCGCCATCGCGCCGATCGTCGTCAAGGCCGTGGCGC
AGCCTGAGCCGCCGGCCGAGCCCCCCGCCTCTGATACGGTCGGCGAGCCGGCGGACGAAGACGACGCCAC
CGAAGCGGGTGCGGAGGACGGTGGCGACGCCGAAGGCGACGACGTGCCCGAGCTGAGCGAAGACGACGAG
GCGCGGCTGTACGACGATTTGCCGGATCTCTCTGATTTCGATGCCGACACCGAAGTCGTTCATCCGGACG
ACGAAGTGTTGGAAGACGACGACGCGGCACCGACGCCGGCGACGGCGCCGCATAAGCCCATCCTTGACTT
GTCCATTCTTGACAGACCGATCGACCGGAAATGA
 Primer design