SecReT4
Protein ID: 171057550
T4SS name [ID]VirB [210]
Gene symbol-
Locus tagLcho_0862
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T4SS(s) in this replicon]
Location [Strand]925925..927958 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDB1Y1V4
KEGG IDlch:Lcho_0862
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9e-95, Aligned region: 146..576
TraG-D_C [PF12696], Evalue: 2.3e-22, Aligned region: 420..541
TrwB_AAD_bind [PF10412], Evalue: 2.4e-20, Aligned region: 178..548
Protein Sequence: 677 a.a.     [Download]
>gi|171057550|ref|YP_001789899.1| TRAG family protein [Leptothrix cholodnii SP-6]
MSNVHAWIPAGHWPAWLTPRRAAGIGFGLAAFVVLSVAAIYLSAALFLLLNKVDPRRVELTSLWTYWAVY
SPDPAQRKRLLASMTASGIGLLLVLPGALLVAAQPRRRLHGDARFATTAEITRAGLLGGSTDGRPGILIG
RHRGQFISLSGQLSVMLSAPTRSGKGVGVVIPNLLNWPDSVVVLDIKGENHAVTAGFRAKSGQRVYAFAP
FDDQARSHRWNPLTAVRTSPMHRVGDLLAIGQVFYPNDGSGTSSEAFFNDQARNLFLGLGLLLLETPALP
RTIGELLRQSSGKGRALRDHLADQIRGRRIDSKELGPALSDECIDALQRLLSNSENTLSSIVATFNAPLT
IFADAVVDATTSADDFRFEDVRRQRLSIYVHIPPNRLTSARPLLNLFFSQLVSLNTQQLPEHDPSLTVQC
LLVNDEFTTMGRVGVITMSAAFLAGYNLRLLTVVQAMSQLDAVYGDKEARTFATNHGLQILFAPREQRDA
DEYSAMLGHFTERGTSRGHSRSLGPNGSRSVSVNESEQRRALLLPQEFKELGSERLVVIAENCKPVLGEK
IRYHRDPAFTSRLLPPPEVPALDMDLHLARVQQRWRLVEGDLAPDETVSIERLAHDINQLPDHFTELSAQ
QMADACLDFFSEKEAQPSGGTVEAAADEEGVLISNDVAREAAPTPDA
 
Nucleotide Sequence: 2034 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c927958-925925 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGAGCAACGTCCACGCCTGGATTCCTGCTGGTCATTGGCCTGCCTGGCTGACCCCGCGCCGAGCGGCAG
GGATCGGGTTCGGACTGGCCGCATTCGTGGTGCTGTCGGTCGCGGCGATCTACCTCTCGGCCGCCCTGTT
CCTGCTGCTGAACAAGGTCGATCCACGCCGGGTCGAGTTGACCAGCCTGTGGACCTACTGGGCGGTCTAC
AGCCCGGACCCGGCGCAGCGCAAGCGCTTGTTGGCCTCGATGACGGCCTCGGGCATCGGCCTGCTGTTGG
TGCTGCCCGGTGCGCTGCTGGTGGCGGCGCAACCACGCCGTCGGCTGCACGGCGATGCCCGCTTCGCGAC
CACGGCCGAGATCACGCGTGCCGGCCTGCTGGGGGGTTCGACCGATGGCCGGCCCGGCATCCTGATCGGC
CGGCACCGGGGGCAGTTCATCAGCCTGAGCGGCCAGCTCTCGGTGATGCTGTCGGCCCCGACCCGCAGCG
GCAAGGGCGTCGGGGTGGTGATCCCCAACCTGCTGAACTGGCCCGACTCGGTGGTGGTGCTGGACATCAA
GGGCGAGAACCACGCGGTCACGGCGGGCTTCCGGGCGAAGAGCGGCCAGCGGGTCTATGCCTTCGCGCCC
TTCGACGACCAGGCCCGCAGCCACCGCTGGAATCCGCTGACGGCGGTGCGCACGAGCCCGATGCACCGGG
TCGGCGACCTGCTCGCGATCGGCCAGGTGTTCTATCCCAACGACGGCAGCGGCACCTCGTCGGAAGCCTT
CTTCAACGACCAGGCGCGCAACCTCTTCCTCGGGCTGGGCCTGCTGTTGCTGGAGACCCCTGCCTTGCCT
CGCACGATCGGAGAGCTGCTGCGGCAGTCCTCGGGCAAGGGCCGTGCACTACGCGACCACCTGGCCGACC
AGATCCGGGGCCGGCGGATCGACAGCAAGGAACTGGGCCCCGCCCTGTCCGACGAGTGCATCGACGCGCT
GCAGCGCCTGCTGTCGAACTCGGAGAACACGCTGTCCAGCATCGTCGCGACCTTCAACGCACCGCTGACG
ATCTTCGCGGACGCGGTGGTCGATGCGACGACCAGCGCCGACGACTTCCGGTTCGAGGACGTGCGGCGCC
AGCGCCTGTCGATCTACGTGCACATCCCGCCGAACCGGCTGACGAGCGCGCGCCCGCTGCTCAACCTGTT
CTTCTCGCAGCTGGTCAGCCTCAACACCCAGCAGCTACCCGAGCACGACCCCAGCCTGACGGTGCAGTGC
CTGCTGGTCAACGACGAGTTCACGACCATGGGCCGGGTCGGAGTGATCACGATGTCGGCGGCCTTCCTCG
CGGGCTACAACCTGAGGCTGCTGACGGTGGTGCAGGCGATGTCGCAGCTGGACGCGGTCTACGGCGACAA
GGAGGCCCGCACCTTCGCGACCAATCACGGGCTGCAGATCCTGTTCGCGCCACGCGAGCAGCGTGACGCC
GACGAGTACAGCGCGATGCTGGGGCACTTCACCGAGCGGGGCACCTCGCGTGGGCACAGCCGGTCGTTGG
GGCCGAATGGCAGTCGATCGGTCAGCGTCAACGAGAGCGAGCAGCGCCGTGCGCTGTTGCTGCCTCAGGA
GTTCAAGGAACTCGGCAGCGAGCGCCTGGTAGTGATCGCCGAGAACTGCAAGCCCGTCCTGGGCGAGAAG
ATCCGCTACCACCGCGACCCGGCGTTCACCAGCCGGCTGCTGCCGCCGCCCGAGGTGCCGGCGCTGGACA
TGGACCTGCACCTGGCGCGTGTGCAGCAACGCTGGCGCTTGGTCGAGGGGGACCTGGCGCCGGACGAGAC
GGTGTCCATCGAGCGGTTGGCCCACGACATCAACCAGTTGCCGGACCACTTCACGGAGCTGTCGGCACAG
CAGATGGCCGACGCCTGCCTGGACTTCTTCTCGGAAAAAGAAGCTCAGCCCAGCGGCGGCACCGTCGAAG
CCGCGGCCGACGAGGAAGGCGTCCTGATCTCGAACGACGTCGCCCGAGAAGCGGCCCCTACACCCGATGC
CTGA
 Primer design