SecReT4
Protein ID: 171057551
T4SS name [ID]VirB [210]
Gene symbol-
Locus tagLcho_0863
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T4SS(s) in this replicon]
Location [Strand]927955..929061 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB1Y1V5
KEGG IDlch:Lcho_0863
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.1e-71, Aligned region: 32..340
AAA_22 [PF13401], Evalue: 7.5e-05, Aligned region: 185..259
Protein Sequence: 368 a.a.     [Download]
>gi|171057551|ref|YP_001789900.1| P-type DNA transfer ATPase VirB11 [Leptothrix cholodnii SP-6]
MRTPMNTDLLVDGSDAQAWSGDATSVVEFLRPLREHLDRPGVLEVCLNQPGELQIESVSGWQAVAAPEMT
QERCLSLATAVATFCDQQINQERPLLSATLPSGERIQFVIPPAVPRGTVSITVRKPSQLVKRLDDFEHEG
LFERTADATRLQDRDGPAFEPFERNLVALKDAGRYADFLRLAVRQHQTIVVSGRTGSGKTTFMKGLVEEV
PRHERLITIQDTAELTLPHHPNVVHLFYSKDAQGTARVTAKSLLEACLRMKPDRIFLAEVRGDECFHFVR
LAASGHPGSITSLHAGSCALALEQMSLMIRECGAGGGLRMDEIKSLLAMVVDVIVQFDRDEHGRFISEIA
YTPRAQRSAQAHRAGSPS
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c929061-927955 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGAGAACCCCGATGAACACGGACCTCTTGGTCGATGGGTCGGACGCGCAGGCCTGGTCCGGCGACGCCA
CCTCGGTGGTGGAGTTCCTGCGGCCGCTGCGCGAGCACCTCGACCGACCCGGCGTGCTGGAGGTCTGCCT
GAACCAGCCCGGCGAACTGCAGATCGAGTCGGTGAGCGGCTGGCAGGCGGTCGCCGCACCCGAGATGACC
CAGGAGCGCTGCCTGTCGCTGGCCACCGCGGTGGCCACCTTCTGCGACCAGCAGATCAACCAGGAACGCC
CGCTGCTGTCGGCCACGCTGCCCAGCGGCGAGCGCATCCAGTTCGTGATCCCGCCGGCCGTGCCCCGCGG
CACCGTGTCGATCACGGTGCGCAAACCCTCGCAGTTGGTCAAGCGGCTGGACGACTTCGAGCACGAGGGC
CTGTTCGAGCGCACCGCCGATGCGACGCGGCTGCAAGACCGCGATGGGCCGGCGTTCGAGCCCTTCGAAC
GCAATCTGGTGGCCCTGAAGGACGCCGGCCGCTACGCCGACTTCCTGCGCCTGGCGGTGCGCCAGCACCA
GACCATCGTCGTCAGCGGTCGGACCGGCTCGGGCAAGACCACCTTCATGAAAGGCCTGGTCGAGGAGGTG
CCCCGGCACGAGCGCCTGATCACGATCCAGGACACCGCCGAGCTGACGCTGCCGCACCACCCCAACGTCG
TGCACCTGTTCTACAGCAAGGACGCGCAGGGCACGGCACGCGTGACGGCCAAGTCGCTGCTCGAAGCCTG
CCTGCGCATGAAGCCGGATCGGATCTTCCTGGCCGAGGTGCGCGGCGACGAGTGTTTCCATTTCGTGCGG
CTGGCCGCCTCGGGCCACCCGGGCAGCATCACCAGCCTGCACGCGGGCAGCTGCGCCCTGGCGCTGGAGC
AGATGTCGCTGATGATCCGCGAGTGCGGCGCCGGCGGCGGGCTGCGCATGGACGAGATCAAGTCGCTGCT
GGCGATGGTGGTCGACGTGATCGTGCAGTTCGATCGCGACGAGCACGGGCGCTTCATCTCGGAGATCGCG
TACACGCCACGCGCACAGCGGTCGGCACAGGCGCACCGTGCAGGCAGCCCGTCATGA
 Primer design