SecReT4
Protein ID: 171057554
T4SS name [ID]VirB [210]
Gene symbol-
Locus tagLcho_0866
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T4SS(s) in this replicon]
Location [Strand]931497..932369 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB1Y1V8
KEGG IDlch:Lcho_0866
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.6e-44, Aligned region: 67..280
Protein Sequence: 290 a.a.     [Download]
>gi|171057554|ref|YP_001789903.1| VirB8 family protein [Leptothrix cholodnii SP-6]
MTRTTNDVRDDFFDSDWQALRQSDLARDPVDAVESEPAHSAPSAPSSLPAQPPPPPPIEDLAYQGNQTWE
IDRAQLLERSERRAWQVAVAAGLLALTGITAVFVQGPLRRIVEIPIVVDRVTGETTIQQRLDVETIPTME
ALDKHNLAAFVRAREGYSWMFLQRDFDQVARMAAQPVFGDYARLFEGDAALQKKLGASEDWRIRIVGVRL
SPTGRKGNRGDATVTYDKAVRQTDRNLAEVVTRHVASVVFQYQPQALSKEADRLENPFGFVVTAYRSDPE
INTAASGAKP
 
Nucleotide Sequence: 873 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c932369-931497 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGACTCGGACCACGAATGACGTCAGGGACGACTTCTTCGACAGCGACTGGCAGGCCCTGCGTCAGTCGG
ATCTGGCGCGCGATCCGGTCGACGCGGTCGAATCGGAACCGGCGCACTCGGCGCCATCGGCCCCATCCTC
ACTGCCAGCACAGCCACCACCACCGCCGCCCATCGAAGACCTCGCTTACCAAGGCAATCAGACCTGGGAG
ATCGACCGCGCCCAGCTGCTCGAACGCTCCGAACGCCGCGCCTGGCAGGTGGCCGTCGCGGCCGGCCTGC
TCGCGCTGACCGGCATCACAGCGGTGTTCGTGCAGGGGCCGCTGCGCCGCATCGTCGAGATCCCCATCGT
GGTCGACCGCGTCACCGGCGAGACTACGATCCAGCAGCGCCTGGACGTCGAGACCATTCCGACGATGGAG
GCGCTGGACAAGCACAACCTCGCCGCCTTCGTGCGGGCCCGCGAGGGCTACAGCTGGATGTTCCTGCAGC
GCGACTTCGACCAGGTTGCGCGCATGGCGGCGCAGCCGGTGTTCGGGGACTACGCGCGGCTGTTCGAAGG
CGACGCGGCACTGCAGAAGAAGCTCGGCGCCAGCGAGGACTGGCGCATCCGCATCGTCGGCGTGCGGCTC
TCGCCGACCGGCCGCAAGGGCAACCGCGGTGACGCCACCGTCACCTACGACAAGGCCGTGCGGCAGACCG
ACCGCAACCTGGCCGAGGTCGTGACCCGCCACGTCGCCAGCGTCGTCTTCCAGTACCAGCCCCAGGCGCT
GAGCAAGGAAGCCGACCGCCTGGAGAACCCCTTCGGTTTCGTCGTGACCGCCTACCGGTCCGACCCCGAG
ATCAACACCGCCGCATCGGGAGCCAAGCCATGA
 Primer design