SecReT4
Protein ID: 172055996
T4SS name [ID]VirB [467]
Gene symbolpilX1
Locus tagPMIP07
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]2685..3320 [+]
Productputative transglycosylase
Component typeVirB1
UniProt IDB1VJ45
KEGG IDpmr:PMIP07
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 4.2e-19, Aligned region: 9..140
Protein Sequence: 211 a.a.     [Download]
>gi|172055996|ref|YP_001812457.1| putative transglycosylase [Proteus mirabilis]
MIKETLLSLALQCAPSVHTDTVIDIAKTESGFNPFAIAEIVTKDKIISHLPKSKNEALEIIERLETKNGR
FSVGLMQIYSGNFKGYNVTAEEMLNPCSNLKIAEKILVDCFQRGGNLKNALSCYYSGNFETGHKKETAFN
NTSYIERIGGQPIERTKTTVVVPSTKTIKQANTTQGNGNKTSLRHTSSIIYPEYIIRGQVTMHLQKVNDE
Q
 
Nucleotide Sequence: 636 bp     [Download]
>gi|172055989|ref|NC_010555.1|:2685-3320 Proteus mirabilis plasmid pHI4320, complete sequence
ATGATTAAAGAAACGTTACTCTCATTAGCTTTGCAATGTGCCCCGTCAGTGCATACTGATACGGTGATAG
ATATTGCAAAAACGGAAAGCGGATTCAATCCGTTTGCCATTGCGGAGATCGTAACGAAAGATAAAATCAT
TAGTCATTTGCCGAAATCAAAAAATGAAGCTCTGGAAATTATCGAAAGGCTGGAAACAAAAAACGGACGA
TTTTCAGTTGGTCTGATGCAAATCTACTCCGGAAATTTTAAAGGGTATAACGTTACCGCAGAGGAAATGT
TGAACCCGTGCAGTAATCTTAAAATAGCAGAAAAAATACTGGTAGATTGCTTTCAACGTGGAGGAAATTT
AAAGAACGCATTAAGTTGTTATTACTCCGGTAATTTTGAAACAGGACACAAAAAAGAAACAGCATTTAAT
AATACCAGTTATATAGAGAGGATAGGAGGGCAGCCTATTGAAAGAACAAAAACAACGGTAGTTGTTCCAA
GCACAAAAACAATTAAACAAGCGAATACAACACAGGGAAATGGAAATAAAACAAGTTTAAGGCACACCTC
ATCAATAATATATCCTGAATATATTATTCGAGGTCAGGTAACAATGCATTTGCAAAAGGTGAATGATGAA
CAGTAA
 Primer design