SecReT4
Protein ID: 172055997
T4SS name [ID]VirB [467]
Gene symbolpilX2
Locus tagPMIP08
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]3340..3588 [+]
Productputative conjugal transfer protein
Component typeVirB2
UniProt IDB1VJ46
KEGG IDpmr:PMIP08
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1e-06, Aligned region: 1..79
Protein Sequence: 82 a.a.     [Download]
>gi|172055997|ref|YP_001812458.1| putative conjugal transfer protein [Proteus mirabilis]
MMVFMGLFMVEPALAAGVDTASTGILQKWIDWLVGIRGAAITLAVIAGALIILFARKYIGFLWGIGFAIF
LFVIAPYVKDWL
 
Nucleotide Sequence: 249 bp     [Download]
>gi|172055989|ref|NC_010555.1|:3340-3588 Proteus mirabilis plasmid pHI4320, complete sequence
ATGATGGTTTTTATGGGGCTGTTTATGGTTGAACCCGCTCTTGCCGCAGGGGTTGATACTGCATCAACAG
GGATTCTCCAAAAATGGATTGATTGGTTAGTCGGGATTCGGGGAGCCGCTATTACACTGGCAGTAATTGC
AGGGGCATTGATTATACTGTTTGCCCGTAAATATATCGGTTTTCTGTGGGGGATTGGTTTTGCTATTTTC
CTCTTTGTGATTGCCCCTTACGTGAAAGACTGGCTGTAA
 Primer design