SecReT4
Protein ID: 172055998
T4SS name [ID]VirB [467]
Gene symbolpilX4
Locus tagPMIP09
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]3610..6384 [+]
Productputative conjugal transfer protein
Component typeVirB4
UniProt IDB1VJ47
KEGG IDpmr:PMIP09
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 9.5e-43, Aligned region: 277..479
AAA_10 [PF12846], Evalue: 7e-29, Aligned region: 544..837
VirB3 [PF05101], Evalue: 7.1e-18, Aligned region: 2..82
Protein Sequence: 924 a.a.     [Download]
>gi|172055998|ref|YP_001812459.1| putative conjugal transfer protein [Proteus mirabilis]
MSVVFKGLTRPALIRGLGVPLYPFLFMIMVVVVIAANTSDYMYFLIPVGWFLIKKMTEIDDRVFDLLYLR
YRVSGHPVSNQKYDAVHYSGNTYDKVDISKLEKMMKLNHQTPIEDMIPFSTHITDKLVCTRKQDLIATWE
IDGAYFECQAEDELDRLTDRLNTLIRSFEDKAVTFYTHRIRTKSKIEKNFRSLVPFANRVMNDYYDSLSQ
ECFYKNRLFISLCYKPLTADEKLTFLFSKNKKEKEKQNKKILTESIAVMNDMTGRLDNYLEQFNATRLGV
YEEKNRVFSSQLSLFQYLLTGKWQKIAITNSPFYNSLGGKDVFFGSDSGQLSAGSDARYFRIIEIKDYFQ
HTESGIFDALMYVPVEYIMTSSFTILRKKESTKRLDDQLDKLVIANDAAVTQQNQLIVGTDMLASGLIAF
GNASFSLLVYADSPEELIKNSNMVANILQDLGLVVTYSGLSLGAAYFAQLPANYTLRPRLSMISSLNFVE
MESFHNFFSGKEKNNSWGDALITLKGSGNDVYHMNYHMTREGVNDFGKNPPLAHTEILGASGGGKTVLMM
AHALAAQQYGMADSFPDNRKIKKLTTVFFDKDRAGEVAIRAMGGEYFKIKSGEPTGWNPFQLAPTKRNIA
FLKELVRILCTVNGGELDDHQLQLISDAVERLMQRDNRTYGISKLIPLIMEDRDGTTLKTGLKVRLNAWA
KDGEFGWVFDNENETFDINEKSVFGVDGTEFLDDKVTSQVIPFYLIYKVASLADGRRLLIYMDEFHQWLV
NESMQKSIYNILKTGRKLDMVLVFATQSPDELIKTPIAAAVREQCATHIYLSNPKATREDYVNGLQVSEL
YFDIIKNIDPLSRMHLVVKNPQRKGDKTEFAAFAKLDLGQAAKYLPILSASSDQMVIFDEIYQEGMKPEE
WIDVYLNQVNKISH
 
Nucleotide Sequence: 2775 bp     [Download]
>gi|172055989|ref|NC_010555.1|:3610-6384 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAGTGTTGTTTTTAAAGGATTAACCCGCCCCGCTTTAATTCGGGGCTTAGGTGTACCGCTGTACCCGT
TTTTATTCATGATTATGGTGGTCGTCGTTATCGCAGCAAACACAAGCGATTATATGTATTTTTTAATTCC
GGTCGGTTGGTTCTTGATTAAAAAAATGACGGAAATTGATGATCGGGTGTTTGATTTGTTGTATTTGCGT
TATCGAGTGAGTGGTCATCCAGTCAGTAATCAGAAATATGATGCTGTACACTATTCAGGAAACACATACG
ATAAGGTCGATATATCAAAACTGGAAAAAATGATGAAACTAAATCACCAAACCCCGATTGAAGATATGAT
CCCATTTTCTACACATATAACAGATAAGTTGGTATGCACTCGTAAGCAGGATTTAATTGCTACTTGGGAA
ATTGACGGGGCTTATTTTGAATGTCAGGCTGAGGATGAGCTAGATCGTTTAACAGATCGTTTGAATACGC
TCATTCGTAGTTTTGAGGATAAAGCTGTAACTTTTTATACTCACCGGATAAGAACGAAAAGTAAAATAGA
AAAGAACTTCCGTTCTCTTGTCCCTTTTGCTAACAGAGTAATGAATGATTACTATGACTCTTTAAGTCAG
GAATGTTTTTATAAAAATCGTCTTTTTATCTCTTTATGTTATAAGCCGTTAACGGCAGATGAGAAGTTAA
CGTTTCTTTTTTCCAAAAATAAAAAAGAGAAAGAAAAACAAAACAAAAAAATATTAACAGAATCGATAGC
TGTCATGAATGATATGACAGGAAGATTAGATAACTATCTTGAGCAGTTTAATGCAACTCGTTTAGGTGTG
TATGAAGAAAAAAACAGAGTGTTTTCTTCTCAGCTATCTTTATTCCAGTATCTTTTAACAGGGAAATGGC
AAAAAATAGCCATCACTAATAGCCCATTTTATAATTCATTGGGTGGGAAAGATGTTTTCTTCGGTAGTGA
TTCAGGTCAGTTATCCGCCGGAAGTGATGCGCGTTATTTCCGTATTATTGAGATAAAGGATTATTTTCAA
CATACCGAATCCGGTATTTTTGATGCGCTGATGTATGTTCCTGTGGAATATATTATGACCAGTAGCTTTA
CCATTTTAAGGAAAAAAGAATCAACAAAAAGATTAGATGATCAGTTAGATAAATTGGTTATTGCTAATGA
TGCAGCAGTCACACAACAAAATCAGCTTATTGTGGGAACTGATATGTTAGCCAGTGGATTGATTGCATTT
GGTAATGCCAGTTTTTCATTGTTAGTTTATGCGGATTCACCGGAAGAATTAATAAAAAATAGCAATATGG
TTGCAAATATCTTACAGGATTTAGGATTGGTTGTGACATATTCAGGTTTATCTTTAGGAGCGGCTTATTT
TGCTCAGTTACCTGCTAATTATACACTGCGTCCTCGCCTGTCGATGATAAGTAGCCTGAATTTTGTGGAA
ATGGAATCATTTCATAATTTCTTTTCAGGAAAAGAAAAAAATAACTCATGGGGCGATGCGTTAATCACTC
TTAAAGGATCAGGTAATGATGTGTACCACATGAATTACCACATGACCCGTGAGGGTGTTAATGATTTTGG
TAAGAACCCGCCGCTGGCTCATACTGAGATATTAGGCGCATCAGGGGGAGGGAAAACGGTCTTGATGATG
GCTCATGCGTTAGCTGCACAACAATATGGAATGGCTGATTCATTTCCTGATAACCGGAAAATAAAAAAAC
TAACCACTGTTTTTTTTGATAAAGACCGTGCGGGAGAAGTAGCCATAAGAGCTATGGGCGGTGAATATTT
TAAAATTAAAAGTGGTGAACCTACAGGCTGGAATCCATTTCAGTTAGCCCCGACAAAACGCAACATTGCC
TTTTTAAAAGAACTGGTAAGAATTTTGTGTACTGTAAATGGCGGAGAACTGGACGATCATCAATTACAGT
TAATTTCAGATGCTGTAGAACGCTTAATGCAACGGGATAACCGTACATATGGTATCAGTAAACTAATTCC
TTTAATTATGGAGGACAGAGACGGAACAACGTTAAAAACGGGATTAAAAGTCCGGCTGAATGCATGGGCG
AAAGATGGGGAGTTTGGTTGGGTATTCGATAATGAAAATGAAACTTTTGATATAAATGAGAAATCTGTAT
TTGGGGTAGACGGCACGGAATTTTTAGACGACAAAGTCACCTCACAGGTGATCCCATTCTACCTTATTTA
TAAGGTTGCATCATTAGCCGATGGTCGTCGCCTGTTAATATATATGGATGAGTTTCATCAGTGGCTTGTT
AATGAAAGTATGCAAAAAAGTATTTATAACATACTGAAAACAGGTAGGAAACTGGATATGGTGCTTGTTT
TTGCTACTCAATCACCTGATGAACTTATTAAAACGCCAATAGCTGCCGCTGTCAGGGAACAATGTGCCAC
ACATATTTATTTGTCTAACCCTAAAGCTACCCGTGAGGATTACGTTAACGGCTTACAGGTCAGTGAATTG
TATTTTGACATTATTAAAAATATTGACCCGCTTTCCCGTATGCACTTAGTGGTCAAAAACCCACAACGCA
AAGGCGATAAAACTGAGTTTGCTGCATTTGCAAAACTCGATTTAGGTCAGGCAGCAAAATATTTACCAAT
ATTAAGTGCATCCAGTGATCAGATGGTGATTTTTGATGAAATTTATCAAGAGGGCATGAAACCGGAAGAA
TGGATTGATGTGTACTTAAATCAGGTCAATAAAATATCACATTAA
 Primer design