SecReT4
Protein ID: 172055999
T4SS name [ID]VirB [467]
Gene symbolpilX5
Locus tagPMIP10
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]6396..7160 [+]
Productputative conjugal transfer protein
Component typeVirB5
UniProt IDB1VJ48
KEGG IDpmr:PMIP10
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 6.9e-29, Aligned region: 25..218
Protein Sequence: 254 a.a.     [Download]
>gi|172055999|ref|YP_001812460.1| putative conjugal transfer protein [Proteus mirabilis]
MKKTVFPLFVALSLFGVAHLGFAAGIPVVDATAIADRLKQDVKTAAQWTKEAAQWTKELKAYQDELLSKT
GIRDVQGLIQDAKEIAGDLTDIYNEGTAFYDNYIENPTGILSEKAQALLDKYKVGEMCVKQGFSGDLIKG
CEARVLSDLASVAYGENLQENINKDNKKMKGLIDQVKSATDPKSTADAANAIALEQLKFEKMKFQYEMYR
DKQAQLSKYKEEMVQAEFKRQQLQATIPDYRKAYKSMQFNDFNN
 
Nucleotide Sequence: 765 bp     [Download]
>gi|172055989|ref|NC_010555.1|:6396-7160 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAAAAAAACAGTATTTCCGTTATTTGTTGCTCTGTCATTATTTGGGGTAGCTCATTTAGGGTTCGCAG
CGGGGATTCCGGTTGTTGATGCTACAGCAATTGCTGATCGTCTGAAACAGGATGTTAAAACGGCTGCACA
ATGGACTAAAGAGGCTGCTCAGTGGACTAAAGAGTTAAAAGCCTATCAGGATGAACTGCTATCAAAAACG
GGTATCCGTGATGTTCAGGGCTTGATTCAGGATGCAAAGGAGATAGCTGGAGATTTAACTGATATCTACA
ATGAGGGAACTGCGTTCTACGATAATTATATTGAAAATCCAACAGGGATTCTGTCAGAAAAAGCACAGGC
ATTACTTGATAAATACAAGGTCGGAGAAATGTGTGTGAAACAAGGGTTTTCCGGCGATCTGATTAAAGGA
TGTGAGGCGCGGGTTTTATCAGATTTAGCCAGTGTAGCTTATGGCGAAAACTTGCAGGAAAATATAAATA
AAGACAATAAGAAAATGAAAGGGCTGATTGATCAGGTGAAATCAGCTACAGATCCAAAATCAACGGCTGA
TGCAGCTAATGCGATTGCTCTTGAACAACTGAAATTTGAAAAAATGAAATTCCAGTATGAAATGTATCGC
GATAAACAGGCTCAACTTTCTAAATATAAAGAGGAAATGGTACAGGCGGAATTTAAACGCCAACAATTAC
AGGCGACCATTCCTGATTATCGTAAAGCCTATAAATCTATGCAGTTTAACGACTTTAACAATTAA
 Primer design