SecReT4
Protein ID: 172056001
T4SS name [ID]VirB [467]
Gene symbolpilX6
Locus tagPMIP12
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]7422..8579 [+]
Productputative conjugal transfer protein
Component typeVirB6
UniProt IDB1VJ50
KEGG IDpmr:PMIP12
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-33, Aligned region: 80..297
Protein Sequence: 385 a.a.     [Download]
>gi|172056001|ref|YP_001812462.1| putative conjugal transfer protein [Proteus mirabilis]
MATTQDAVDSYWGTGLNGGSANFVVPSKPPLEGQPAQYDSNFFQTAHEIITDILKSSTQGKMGEFIDIAY
SLGKFGVQAYILWYIFTILAGKQQKTVPVQDFIWNVVRFTVILLFVRNVDGWLDTSISSIYGLKNLFAGG
DVYLWLDQLWVKTVQTANLIFKLDPSDYVPAAGALGALFTYLGGLVALMCAALTFFAAEVTLMLLTITAP
LFIMCLMFGFLRQMFNSWLQMIFSALLIFLFGGLALRAGTWYLNTILTTNIATASEQNLIYMGASALAGG
IFMAFVIWQAKTYASQIAGVGAEGALQGAAAMGLAAGGFGMGRMALGGLRMGKNASSGLGRGLVGQSGGF
GKSEGFSGKAGNVTGQATRRIGKEVAAIYKKRFGG
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|172055989|ref|NC_010555.1|:7422-8579 Proteus mirabilis plasmid pHI4320, complete sequence
ATGGCAACCACACAAGATGCAGTAGATTCTTATTGGGGAACCGGACTCAACGGCGGCAGTGCTAATTTTG
TTGTGCCAAGTAAACCGCCATTAGAGGGACAGCCAGCCCAATATGACAGTAATTTTTTCCAGACTGCACA
TGAGATTATTACTGATATATTAAAATCGTCCACGCAGGGCAAAATGGGCGAATTTATTGATATCGCTTAT
TCTCTCGGTAAGTTTGGAGTTCAGGCGTATATCCTCTGGTATATTTTTACCATCCTTGCGGGAAAACAGC
AAAAAACCGTTCCGGTTCAGGATTTTATCTGGAATGTTGTTAGGTTTACTGTGATATTGCTGTTTGTCCG
TAACGTGGATGGTTGGCTGGATACGTCTATTTCATCCATTTACGGGCTGAAAAACCTGTTTGCGGGCGGG
GATGTTTATCTTTGGCTTGATCAGCTTTGGGTCAAAACTGTGCAAACAGCAAACCTTATTTTCAAATTAG
ATCCCTCAGATTATGTGCCGGCAGCAGGAGCACTAGGCGCATTATTTACCTATTTAGGCGGGTTAGTTGC
CCTGATGTGTGCCGCCCTGACGTTCTTTGCGGCGGAAGTGACCCTGATGTTACTTACTATCACTGCACCC
TTGTTTATTATGTGTCTGATGTTCGGTTTTCTACGCCAGATGTTTAACAGTTGGTTGCAGATGATTTTCA
GTGCTCTGCTTATTTTTCTGTTCGGTGGTTTGGCTCTACGGGCGGGAACGTGGTATCTGAACACGATACT
GACGACCAACATTGCTACGGCGAGTGAACAGAACCTGATTTATATGGGCGCGAGTGCGCTGGCAGGCGGG
ATTTTTATGGCGTTTGTTATCTGGCAGGCAAAAACCTATGCCTCACAGATTGCCGGAGTCGGGGCTGAGG
GCGCATTGCAGGGAGCGGCTGCTATGGGGCTTGCCGCAGGCGGTTTTGGTATGGGACGCATGGCTTTAGG
CGGTTTACGAATGGGGAAAAACGCAAGCTCTGGTTTGGGACGGGGACTTGTCGGGCAATCCGGCGGATTT
GGTAAATCGGAAGGCTTTTCCGGTAAAGCAGGGAATGTGACCGGACAGGCGACACGCCGGATCGGAAAAG
AGGTCGCGGCGATTTATAAAAAACGGTTTGGGGGATGA
 Primer design