SecReT4
Protein ID: 172056002
T4SS name [ID]VirB [467]
Gene symbolpilX7
Locus tagPMIP12A
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]8583..8717 [+]
Productconjugal transfer protein
Component typeVirB7
UniProt IDB1VJ52
KEGG IDpmr:PMIP12A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 44 a.a.     [Download]
>gi|172056002|ref|YP_001812463.1| conjugal transfer protein [Proteus mirabilis]
MKKFLFLIIVSIGLVGCASQKTVPPVSGGLEPVNTPEVMNTAGK
 
Nucleotide Sequence: 135 bp     [Download]
>gi|172055989|ref|NC_010555.1|:8583-8717 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAAAAAGTTTCTGTTTCTGATTATTGTCAGTATTGGATTAGTTGGTTGTGCCAGTCAAAAAACAGTTC
CCCCCGTGTCGGGGGGATTAGAGCCTGTTAATACTCCGGAAGTAATGAATACCGCAGGGAAATGA
 Primer design