SecReT4
Protein ID: 172056003
T4SS name [ID]VirB [467]
Gene symbolpilX8
Locus tagPMIP13
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]8719..9426 [+]
Productconjugal transfer protein
Component typeVirB8
UniProt IDB1VJ53
KEGG IDpmr:PMIP13
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-47, Aligned region: 23..231
Protein Sequence: 235 a.a.     [Download]
>gi|172056003|ref|YP_001812464.1| conjugal transfer protein [Proteus mirabilis]
MKKIQFFKNKETAIENAALFEDVIYKKEQRLKWVYLGTGILGALIGVLSLIALIIVLPLKETETYIYSVD
NQTGRAEEMTKVTNSTLNENEAVSRFFVDTYLKAREGYNYFRLQQDYDLVMSYSSDSVGNEYTAIFKSPQ
APQTIYRKGEQTVKVDVLSKIISDSSKADDPDKLASVRYKRTITEVLTGSKREEFWVARITFRFIPENNL
TREERDSNPLGFVVTSYLTEKENRG
 
Nucleotide Sequence: 708 bp     [Download]
>gi|172055989|ref|NC_010555.1|:8719-9426 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAAAAAAATTCAATTTTTTAAAAACAAAGAAACTGCCATAGAAAACGCGGCGTTATTTGAAGATGTGA
TTTATAAAAAAGAACAACGTCTGAAATGGGTTTACTTAGGAACGGGTATTTTAGGGGCTTTAATTGGTGT
GCTGAGTCTGATTGCTCTTATTATTGTTTTACCGCTGAAAGAAACGGAAACATATATTTATTCCGTTGAT
AATCAGACTGGCAGAGCAGAAGAAATGACAAAAGTCACGAACAGTACATTAAATGAAAATGAAGCGGTAA
GTCGTTTCTTTGTTGATACCTATCTCAAAGCTAGAGAGGGATATAATTATTTTCGTTTGCAACAGGATTA
TGATCTGGTCATGTCATACAGCAGTGACAGTGTGGGAAATGAATACACTGCTATATTTAAATCTCCACAA
GCACCGCAGACGATTTACAGGAAAGGTGAACAAACGGTTAAGGTTGACGTTTTATCAAAAATTATTTCGG
ATTCATCAAAAGCTGACGACCCTGATAAGCTTGCCAGTGTTCGTTACAAACGGACAATTACCGAAGTTTT
AACGGGTTCTAAACGTGAAGAATTTTGGGTTGCAAGAATCACATTTCGCTTTATTCCTGAAAACAACCTG
ACACGGGAAGAAAGAGACAGCAATCCATTGGGGTTTGTTGTTACCAGTTATTTAACAGAAAAGGAAAACA
GGGGTTAA
 Primer design