SecReT4
Protein ID: 172056004
T4SS name [ID]VirB [467]
Gene symbolpilX9
Locus tagPMIP14
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]9429..10352 [+]
Productconjugal transfer protein
Component typeVirB9
UniProt IDB1VJ54
KEGG IDpmr:PMIP14
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.5e-50, Aligned region: 31..283
Protein Sequence: 307 a.a.     [Download]
>gi|172056004|ref|YP_001812465.1| conjugal transfer protein [Proteus mirabilis]
MNKNIIALFLSVFVIAMNANAASKPTGSRFDPRNQIISYNPSDTTVINSAAGYVSVLVFDDDEKVMETDV
GFEQGWNIRSSENKVYIKVTPVTQTIEAVNDDGETEQKQMVFDPESDLNQFKTNLFIVTTKRNYSVELNA
KTFKEPEKISFVVNYRYPNEVRKEKEKLEQQRIAELKRKQEINEINKSFENAKVPRNWKYYQRVANNSEY
IKPDYAYDDGRFTYFGFNPSKKIPSVFVQYGEQETITNPTVEKKGDYTVVIIHQTNDRWVLRSGDQVVGV
ENKGYGLVRLADSDTVSPDVKKEIKND
 
Nucleotide Sequence: 924 bp     [Download]
>gi|172055989|ref|NC_010555.1|:9429-10352 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAATAAAAATATAATCGCTTTATTCCTGTCTGTTTTCGTTATCGCCATGAATGCAAATGCAGCCAGTA
AACCAACAGGCAGTCGGTTCGACCCCCGTAATCAGATAATTAGCTATAATCCATCTGATACAACCGTAAT
CAATAGTGCTGCTGGTTATGTTTCTGTCTTGGTTTTCGACGATGACGAAAAAGTGATGGAAACCGATGTT
GGATTTGAGCAGGGCTGGAACATCAGGTCATCAGAAAATAAAGTGTACATAAAAGTCACGCCTGTGACAC
AAACCATTGAAGCGGTAAATGATGATGGTGAAACAGAACAAAAACAAATGGTTTTTGATCCGGAGTCAGA
TTTAAATCAATTCAAAACAAATTTGTTTATTGTGACAACAAAAAGAAATTACAGTGTTGAATTAAATGCA
AAAACATTTAAAGAACCTGAGAAAATTTCGTTTGTTGTAAATTATCGTTATCCGAACGAGGTGAGAAAGG
AAAAAGAAAAACTTGAGCAACAACGTATTGCGGAATTAAAAAGAAAGCAGGAAATAAATGAAATAAATAA
ATCATTTGAAAATGCCAAAGTTCCGCGAAACTGGAAATATTATCAGCGCGTGGCTAACAACAGCGAATAC
ATTAAACCGGATTATGCTTATGATGATGGGCGATTTACTTATTTTGGTTTTAACCCGTCCAAAAAAATCC
CAAGCGTCTTTGTTCAGTATGGTGAGCAGGAAACAATAACTAATCCGACTGTTGAAAAGAAAGGTGATTA
TACCGTTGTGATTATACATCAGACAAATGATCGTTGGGTTTTACGTTCAGGTGATCAGGTTGTTGGTGTG
GAGAATAAAGGGTATGGACTTGTCCGGTTAGCTGATTCTGATACGGTTTCCCCTGATGTGAAAAAGGAAA
TAAAAAATGACTGA
 Primer design