SecReT4
Protein ID: 172056005
T4SS name [ID]VirB [467]
Gene symbolpilX10
Locus tagPMIP15
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]10345..11547 [+]
Productconjugal transfer protein
Component typeVirB10
UniProt IDB1VJ55
KEGG IDpmr:PMIP15
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.8e-49, Aligned region: 206..388
Protein Sequence: 400 a.a.     [Download]
>gi|172056005|ref|YP_001812466.1| conjugal transfer protein [Proteus mirabilis]
MTDEQKPKTAAELENEMLAVRENVSTNNHIEDEDTAETPKPRLGIHSLKKTFKGKLLLGGIFVILLAGAA
VYNFPDILRGMFSSEKTTQDDTINTTKSNRLTDLNKDTAFDPAEASVSSEVKNNKTESASASTSDGGAKV
VNVPSAPATFSRSLAVRIGSGGTGSQNNQNTNGEDTAAVSTVPTTTETEKRSLSAIKVLPYDPNLFIPEN
TSIPCSLDRRFVSDLSGSLTCTVIEDIYSANGNVRLIDKGTRASLIYKAGTLKHGQGRVFIMATKLRTRQ
QPFIDIPLIDTAAAGALGEMGADGWIDTHFWDRFSGAMMLGMIPDLTQGVSGAIKNNKDNQTDYTANSRQ
AFADIAKEAFANSVGIPPTLYKNQGEIITLITGEDLDFSTIYQLKMSKGK
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|172055989|ref|NC_010555.1|:10345-11547 Proteus mirabilis plasmid pHI4320, complete sequence
ATGACTGATGAACAAAAACCAAAAACCGCTGCTGAGTTAGAAAATGAAATGCTTGCGGTAAGAGAAAACG
TCAGCACGAATAATCATATAGAAGATGAAGATACTGCGGAAACGCCGAAACCTCGTTTAGGTATTCACTC
ACTTAAGAAAACGTTTAAAGGTAAATTACTTTTAGGCGGGATTTTTGTAATCCTACTGGCGGGTGCGGCT
GTTTACAATTTTCCTGATATTCTTCGGGGGATGTTTTCATCAGAAAAAACAACACAGGACGACACCATTA
ATACGACGAAAAGCAACCGTCTGACAGATTTGAATAAAGATACGGCGTTTGATCCGGCAGAAGCATCTGT
TTCATCGGAAGTGAAAAACAATAAGACTGAGTCGGCTTCTGCCAGTACGTCAGACGGAGGTGCAAAGGTT
GTTAATGTTCCGTCTGCTCCGGCAACATTCAGCCGTTCACTGGCTGTCAGAATTGGTTCAGGGGGAACAG
GAAGCCAAAATAATCAAAATACTAATGGAGAAGATACTGCGGCAGTCAGTACCGTTCCGACCACGACAGA
GACAGAAAAACGTTCACTGAGCGCGATTAAAGTGTTGCCGTATGACCCTAATCTGTTTATTCCTGAAAAT
ACTTCAATTCCCTGCTCGTTGGACAGGCGTTTTGTGTCTGATTTAAGTGGTTCGCTGACCTGCACAGTGA
TTGAGGATATTTACAGCGCAAACGGCAATGTTCGGCTGATAGATAAAGGTACTCGGGCGAGTCTGATTTA
TAAAGCGGGTACGCTGAAACACGGACAGGGGCGCGTTTTCATTATGGCGACAAAACTCAGAACCCGCCAA
CAGCCTTTTATTGATATTCCGTTGATAGATACGGCAGCAGCGGGGGCATTAGGTGAAATGGGGGCGGATG
GCTGGATTGATACCCATTTTTGGGACAGATTCAGCGGAGCAATGATGCTTGGAATGATCCCCGATCTTAC
TCAGGGAGTCAGTGGAGCAATTAAAAACAATAAAGACAATCAGACGGACTATACCGCTAACAGCCGTCAG
GCATTTGCGGATATTGCCAAAGAAGCGTTTGCTAACAGTGTCGGTATTCCGCCTACGCTATACAAAAATC
AGGGGGAGATTATTACGTTGATTACAGGGGAAGATCTCGATTTTTCGACTATTTACCAGTTAAAAATGAG
TAAAGGCAAATGA
 Primer design