SecReT4
Protein ID: 172056006
T4SS name [ID]VirB [467]
Gene symbolpilX11
Locus tagPMIP16
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]11544..12578 [+]
Productconjugal transfer protein
Component typeVirB11
UniProt IDB1VJ56
KEGG IDpmr:PMIP16
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.5e-51, Aligned region: 19..311
Protein Sequence: 344 a.a.     [Download]
>gi|172056006|ref|YP_001812467.1| conjugal transfer protein [Proteus mirabilis]
MSNNNHIVNEIAAQFFGEALTQTDGLTEIAVNRPNQMYLKVKGKWIKKDTLISYDDCKSFASALADFCSD
SVSETKPILSATLPTGERVQVVLPPATEQDTISITIRKPSDIFISHEMFVEQGFYSKLDTQAGNIISPAT
KKLTDLYNSGDIETFIPECLKQGKTIAFCGGTGSGKTTFGNSLLEYIPNHLRVISIEDTPEVKLRFHDNH
VRLFYPSEGGKNSIITPAMLLRACYRMNPDRILMTEVRGAEAWDFLKGNSSGHAGGITTLHEDTPMYAVS
GMIERCQQNPECHNLPYNVLLRKVLNNIDVILSIKYLDEFDKRYATGIYFKDIHKEQYFNELRD
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|172055989|ref|NC_010555.1|:11544-12578 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAGTAACAATAACCACATTGTTAATGAAATAGCGGCACAGTTCTTTGGTGAGGCTCTGACTCAGACTG
ACGGTTTAACTGAGATTGCAGTTAACCGCCCTAATCAAATGTACCTGAAAGTAAAGGGTAAATGGATAAA
AAAAGATACATTAATCAGCTATGATGATTGTAAATCATTTGCCTCAGCACTGGCTGATTTTTGCAGTGAT
TCAGTCAGTGAAACAAAACCCATTCTCTCCGCAACATTACCGACAGGAGAGCGGGTTCAGGTTGTTCTTC
CTCCGGCAACGGAACAAGATACTATTTCTATCACTATCCGTAAGCCGTCCGATATTTTTATCAGCCATGA
AATGTTTGTTGAGCAGGGGTTTTATTCAAAATTAGACACGCAAGCAGGAAACATCATCAGTCCTGCCACG
AAGAAGTTAACTGATTTATACAATTCCGGTGATATTGAAACCTTTATTCCTGAATGCCTGAAACAGGGAA
AAACCATTGCATTTTGCGGAGGAACCGGCAGCGGGAAAACTACTTTTGGAAACTCCTTGCTGGAATATAT
CCCGAATCATCTGCGAGTCATTTCTATTGAAGATACTCCGGAGGTAAAGCTGCGGTTTCATGACAATCAT
GTCAGGCTGTTTTACCCGTCTGAGGGCGGAAAAAACAGCATCATAACGCCAGCTATGCTGTTACGTGCCT
GTTATCGCATGAATCCAGACCGTATTTTAATGACCGAAGTCAGGGGGGCGGAAGCTTGGGATTTTTTAAA
AGGGAACAGTTCGGGGCATGCAGGAGGGATTACTACATTGCATGAAGATACACCGATGTATGCTGTTTCC
GGAATGATAGAACGTTGTCAGCAAAATCCGGAGTGCCACAATTTACCGTATAACGTCCTGCTCCGAAAGG
TGCTAAATAATATTGATGTAATACTGAGCATTAAATATTTGGACGAATTTGATAAAAGGTATGCGACAGG
AATTTACTTTAAAGATATTCATAAAGAGCAGTATTTTAACGAATTAAGGGACTGA
 Primer design