SecReT4
Protein ID: 172056007
T4SS name [ID]VirB [467]
Gene symboltaxB
Locus tagPMIP17
StrainProteus mirabilis HI4320
Repliconplasmid pHI4320 [GenBank: NC_010555] [Browse all T4SS(s) in this replicon]
Location [Strand]12581..14434 [+]
Productconjugal transfer protein
Component typeVirD4
UniProt IDB1VJ57
KEGG IDpmr:PMIP17
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.4e-136, Aligned region: 103..582
TraG-D_C [PF12696], Evalue: 5.8e-27, Aligned region: 421..540
TrwB_AAD_bind [PF10412], Evalue: 2.6e-20, Aligned region: 338..554
Protein Sequence: 617 a.a.     [Download]
>gi|172056007|ref|YP_001812468.1| conjugal transfer protein [Proteus mirabilis]
MKLTLPDKKQWLFIVGLMGLISYYAGSVAVYFLNGYNIKFLFNKYDSGVLGTILTQSEFTSKLWLSGVTA
LGVGFAVSLIAPVLIIVLMNKNENSSLYGDAKFASDDDLKKSKLLKWEKENEKGILVGKYKGKYLWYTAP
DFVSLGAGTRAGKGAAIGIPNLLVWLHSLIILDPKQECWKITSKVREILLGHSVYLIDPFNSKTHGINFF
DYIELAKESGAKDLLKLVEILFPSYGSTGAEAHFNNLAGQYFTGLTKLLYVFIYLDKKYPEKNYLNQFKV
KSPVFSIGSVVDLYGSIDRQFVIDESEELLSLPLDSLMLYHLKDGLTKLKEYHLTEDEQRSSIDGSFRKK
MSLFYLPTVRACTDRSDFDLRQLRREKITIYVGINAEDLGIAYDFLNLFFNFVVEVTLRENPDFDPTLKH
PCLLMLDEFPSIGYMPIIKKGSGYIAGFNLKLLTIYQNISQLNEIYGIEGAKTLLSAHPCRVIYAVSEQD
DANQISDKLGYITTKSKSESQSKGRRDSKSESHSETKRALVLPQELSTLDFKEEFIILKGENPVKAEKAL
YFSDNYFMDRLLKVSPKLEDEVKKINKKSTVIGVKGLRYPDKEKMLSLGELESEVFL
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|172055989|ref|NC_010555.1|:12581-14434 Proteus mirabilis plasmid pHI4320, complete sequence
ATGAAACTGACCTTACCGGATAAAAAACAATGGCTATTTATCGTCGGACTGATGGGGTTAATCTCTTATT
ATGCGGGGAGTGTTGCGGTCTATTTTTTAAATGGATATAACATTAAATTCCTTTTTAATAAGTATGACTC
AGGTGTATTAGGGACTATTTTAACACAAAGTGAGTTCACATCTAAATTATGGTTATCCGGCGTGACAGCG
TTAGGGGTTGGGTTTGCTGTCAGTTTAATTGCACCTGTATTGATTATTGTCCTGATGAATAAAAACGAAA
ATTCCTCGCTGTATGGGGATGCGAAATTTGCCAGTGATGATGATTTGAAAAAATCAAAATTATTGAAATG
GGAAAAGGAAAACGAAAAAGGAATTTTAGTCGGAAAATATAAAGGAAAATACCTCTGGTATACCGCCCCT
GATTTTGTTTCACTTGGGGCAGGAACAAGAGCGGGGAAAGGGGCTGCTATTGGTATTCCAAATCTGCTTG
TATGGTTGCATTCTTTGATTATTTTAGACCCTAAACAGGAATGTTGGAAAATTACCAGTAAAGTGAGAGA
AATATTACTAGGACATAGTGTCTATTTAATTGATCCATTCAACAGTAAAACGCACGGCATTAACTTTTTT
GACTACATTGAATTAGCCAAAGAAAGCGGTGCAAAAGATTTACTGAAACTGGTTGAGATTTTATTTCCGT
CCTATGGTTCAACGGGGGCAGAGGCGCATTTCAATAATCTGGCAGGTCAATATTTTACTGGTTTGACAAA
ATTATTGTATGTTTTTATTTATCTGGATAAAAAATATCCCGAAAAAAATTATTTAAATCAGTTTAAGGTT
AAAAGTCCTGTTTTTTCTATCGGCTCGGTTGTAGATCTGTATGGCAGTATTGATAGACAATTTGTAATTG
ATGAAAGCGAAGAATTATTGAGTTTACCATTAGATAGCCTGATGCTTTACCATTTAAAGGATGGGTTAAC
TAAATTAAAAGAGTATCATTTAACGGAGGATGAACAACGTTCGAGTATCGATGGTTCATTCCGTAAAAAA
ATGAGCCTGTTTTATCTGCCTACTGTTCGAGCCTGTACTGACCGCAGCGACTTTGATTTACGGCAATTAC
GCCGTGAAAAAATAACCATTTATGTCGGTATTAATGCAGAAGATCTAGGGATAGCTTATGATTTTCTGAA
TTTATTTTTTAATTTCGTCGTTGAGGTGACGTTACGGGAAAATCCCGATTTTGATCCGACACTAAAACAT
CCTTGTTTATTGATGTTAGACGAATTTCCGTCTATCGGATATATGCCTATTATCAAAAAAGGTTCGGGTT
ATATCGCAGGATTTAACCTTAAATTATTAACTATCTATCAAAACATAAGCCAGTTAAACGAAATTTACGG
CATCGAGGGGGCGAAAACATTGTTAAGTGCTCATCCTTGCAGAGTTATTTATGCTGTCAGTGAACAGGAT
GATGCTAATCAGATATCGGATAAATTAGGTTATATAACAACAAAATCTAAAAGCGAAAGTCAAAGTAAAG
GACGCAGAGATTCAAAGAGCGAATCTCATAGTGAAACAAAAAGGGCGTTGGTGTTACCACAGGAATTAAG
CACTCTTGATTTCAAGGAGGAATTCATCATTCTGAAAGGGGAAAATCCGGTTAAGGCAGAAAAAGCGCTT
TATTTTTCTGATAATTATTTTATGGACAGATTGTTAAAGGTCAGTCCGAAACTTGAAGATGAAGTAAAAA
AAATTAATAAAAAATCAACGGTTATTGGGGTGAAAGGATTACGTTATCCCGATAAAGAAAAAATGCTGTC
ATTAGGTGAATTAGAATCTGAGGTGTTTTTATGA
 Primer design