SecReT4
Protein ID: 172064528
T4SS name [ID]Trb [781]
Gene symbol-
Locus tagBamMC406_6504
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T4SS(s) in this replicon]
Location [Strand]3224..4237 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDB1Z652
KEGG IDbac:BamMC406_6504
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-20, Aligned region: 93..312
Protein Sequence: 337 a.a.     [Download]
>gi|172064528|ref|YP_001812178.1| hypothetical protein BamMC406_6504 [Burkholderia ambifaria MC40-6]
MANDSANWLRRGALTLLVLMLIGVATASSAYAFDLPSGTTGWSSSYQPGEVAKGAMAAIDEIAKIMKDLI
DLAVTLSQPLDQYANKMAGGLAGITIALAGVRYAATRDPVPAWQSLIEDLAILGIFGSIFLMYATWAPGF
YKWFNDMAVAVSGTDAQSLPSAMVKTAGSIFDAVIEAFQAGHWWSYIALAINLLPLLFAWGFLMIASLVF
LFFISLGTIQMAVGIVMGKIALALGMSEFTRGYFKTWLDYMISAGMYMVVAAILQRLVTTTITSAFTNAI
SKGLTTPYAGSLALDLSIFVLILSFEVPKFASMFGGGANASGGAFKSLTKLATKGLA
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c4237-3224 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGCCAACGATTCTGCGAACTGGTTGCGCCGCGGGGCCTTGACGCTGCTCGTGCTGATGCTCATCGGTG
TCGCCACAGCTTCGAGCGCGTACGCGTTCGATTTGCCATCGGGCACCACGGGATGGAGCTCAAGCTACCA
GCCGGGCGAGGTGGCAAAGGGGGCAATGGCGGCGATCGATGAGATCGCGAAGATCATGAAGGATCTGATC
GACCTCGCGGTGACGCTGAGTCAACCGCTCGATCAGTACGCGAACAAGATGGCGGGCGGGCTGGCAGGCA
TCACGATTGCCCTCGCGGGCGTTCGGTATGCCGCAACGCGGGACCCCGTGCCGGCGTGGCAGTCCCTGAT
TGAGGACCTGGCGATTCTCGGCATCTTCGGGTCGATCTTCCTGATGTACGCCACCTGGGCGCCCGGGTTC
TATAAATGGTTTAACGATATGGCGGTAGCTGTGTCCGGCACCGATGCACAGTCGCTTCCGTCCGCGATGG
TCAAAACCGCGGGATCGATCTTCGATGCGGTTATCGAGGCTTTCCAGGCCGGGCATTGGTGGAGCTACAT
CGCGCTGGCGATCAATCTGTTGCCACTGTTGTTCGCGTGGGGCTTTCTGATGATCGCGTCTCTCGTATTT
CTGTTCTTCATTTCGCTGGGCACCATTCAGATGGCCGTCGGCATCGTGATGGGCAAGATCGCCTTGGCGT
TGGGTATGTCGGAGTTCACGCGCGGCTACTTCAAGACCTGGCTTGATTACATGATCAGTGCCGGCATGTA
TATGGTTGTTGCGGCGATCCTTCAGCGCTTGGTGACGACCACGATTACGAGCGCGTTTACCAACGCGATT
TCGAAGGGGCTGACCACACCGTATGCCGGATCGCTGGCGCTTGATCTGTCGATCTTCGTGCTGATTCTGT
CGTTCGAGGTTCCGAAGTTCGCCTCCATGTTCGGCGGCGGCGCGAATGCGAGCGGCGGGGCGTTCAAGAG
TCTGACGAAGCTTGCGACGAAGGGCCTGGCATGA
 Primer design