SecReT4
Protein ID: 172064532
T4SS name [ID]Trb [781]
Gene symbol-
Locus tagBamMC406_6508
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T4SS(s) in this replicon]
Location [Strand]7766..8146 [-]
Producthypothetical protein
Component typeTrbC
UniProt IDB1Z656
KEGG IDbac:BamMC406_6508
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.2e-07, Aligned region: 29..115
Protein Sequence: 126 a.a.     [Download]
>gi|172064532|ref|YP_001812182.1| hypothetical protein BamMC406_6508 [Burkholderia ambifaria MC40-6]
MKKLFNAFAHSASTKVCGAANYLFGRGQIRSTLIAAAIAFATPAAHAVDLSDLGNAASMICLIQAYVSGP
VLFCIGIVVIIMAAIMIANSESNIVKFLATVFIGLGVAACAIPIVKNRMHIDYTCA
 
Nucleotide Sequence: 381 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c8146-7766 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAAGAAGTTGTTCAACGCTTTTGCTCACTCGGCGTCCACCAAAGTATGCGGCGCCGCGAACTACCTGT
TCGGTCGCGGCCAGATCCGCTCCACATTGATCGCTGCTGCGATCGCGTTTGCCACACCGGCAGCCCATGC
GGTGGATCTGAGCGATCTCGGCAACGCAGCGTCGATGATCTGTCTGATCCAGGCCTATGTGAGCGGGCCG
GTGCTGTTCTGTATCGGCATCGTGGTGATCATCATGGCCGCGATCATGATCGCGAACTCCGAGAGCAACA
TCGTCAAGTTTCTCGCGACCGTCTTCATCGGCCTCGGTGTCGCGGCGTGTGCGATTCCGATCGTGAAGAA
CCGCATGCACATCGACTACACCTGTGCGTAA
 Primer design