SecReT4
Protein ID: 172064594
T4SS name [ID]Trb [781]
Gene symbol-
Locus tagBamMC406_6570
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T4SS(s) in this replicon]
Location [Strand]60219..61100 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDB1Z6B8
KEGG IDbac:BamMC406_6570
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.5e-48, Aligned region: 65..285
Protein Sequence: 293 a.a.     [Download]
>gi|172064594|ref|YP_001812244.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia ambifaria MC40-6]
MKRLRTLAACGAVAMIATASALAAKPASPVLPPTPNFDFATIIGDPMSPVNPYNSGTDPITMPGDARMAV
FPYSRDQIFRVMTAPLKVTTIELARGEVLTAEPALGDSIQWVLDTDGANHVFVKPTKPGLVNTLHLTTNM
REYDMTLVSSPVGGLFYQSVRFNYPNSLMAKVRAREGGGSDSAEGNLPGVAAQTDSGPIGVTPDKLNFEY
TVSGSGAIKPETVFDDGKFVWIRLPQNAPFAVPTVREGGDIVSPNFIRRGPYIVVQQLADEITLTRAGEV
VTIKRGRRGLFGF
 
Nucleotide Sequence: 882 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c61100-60219 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAAACGACTCCGTACCCTTGCTGCGTGCGGCGCAGTCGCGATGATCGCGACGGCCAGCGCTCTTGCGG
CAAAGCCCGCGTCGCCAGTGCTTCCACCGACACCGAACTTCGATTTTGCGACGATCATCGGCGATCCGAT
GAGTCCGGTGAATCCGTACAACTCGGGCACAGATCCGATCACCATGCCGGGCGATGCGCGCATGGCCGTG
TTTCCGTACAGCCGCGACCAGATCTTCCGCGTCATGACGGCACCGCTCAAGGTGACAACGATCGAGCTCG
CGCGCGGCGAGGTGCTGACCGCGGAGCCCGCGCTCGGTGACTCCATCCAATGGGTGCTCGATACCGACGG
CGCGAATCACGTTTTCGTGAAGCCGACCAAACCGGGCCTCGTGAACACGCTGCACTTGACCACCAACATG
CGCGAGTACGACATGACGCTCGTGTCGTCGCCGGTCGGCGGCCTGTTCTACCAGTCAGTCCGCTTCAACT
ATCCGAATTCGCTGATGGCGAAAGTTCGTGCGCGCGAGGGTGGCGGCAGTGACAGCGCGGAAGGCAACCT
GCCAGGTGTCGCTGCGCAAACGGACTCCGGCCCGATCGGCGTGACGCCCGACAAGCTGAATTTCGAGTAC
ACCGTGTCCGGGTCTGGCGCGATCAAGCCGGAGACCGTGTTCGACGACGGCAAGTTCGTCTGGATTCGTT
TGCCGCAAAACGCGCCGTTCGCCGTGCCCACGGTAAGAGAGGGCGGAGACATCGTCAGCCCCAACTTTAT
CCGGCGTGGGCCATACATCGTTGTCCAGCAGCTGGCGGACGAAATTACGCTGACGCGCGCGGGCGAAGTG
GTCACGATCAAGCGTGGCCGCCGCGGCCTGTTCGGTTTCTGA
 Primer design