SecReT4
Protein ID: 172087628
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0056
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]25993..26295 [+]
Producttype IV secretion (pTiA6 VirB3)
Component typeVirB3
UniProt IDB1WN90
KEGG IDvfi:VF_B0056
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 7.4e-15, Aligned region: 3..90
Protein Sequence: 100 a.a.     [Download]
>gi|172087628|ref|YP_001816754.1| type IV secretion (pTiA6 VirB3) [Vibrio fischeri ES114]
MSEPIFKACTRPSMLFSVPLVPLMLSNAIIFLVGMWANYFGLGLWLFILTIPNYLTLRFITKLDDANLSL
LGLRFKCRRMNRNRSFYGATVYSPLPFKKR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|59714356|ref|NC_006842.1|:25993-26295 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGTCTGAGCCGATATTTAAAGCCTGTACTCGCCCCTCAATGCTGTTTTCAGTCCCATTAGTACCGTTAA
TGCTCTCTAATGCCATTATCTTTTTAGTTGGCATGTGGGCGAACTACTTTGGTCTTGGACTGTGGCTCTT
TATTCTTACTATTCCGAACTACTTAACTTTACGGTTTATCACCAAATTGGATGATGCCAATCTCAGTCTG
TTAGGACTGAGATTTAAATGTCGTCGAATGAATCGTAATCGTTCTTTTTATGGGGCGACGGTATATAGCC
CTTTACCATTTAAAAAGAGATAA
 Primer design