SecReT4
Protein ID: 172087629
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0057
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]28724..28846 [+]
Producttype IV secretion (pTiA6 VirB7)
Component typeVirB7
UniProt IDB1WN91
KEGG IDvfi:VF_B0057
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 40 a.a.     [Download]
>gi|172087629|ref|YP_001816755.1| type IV secretion (pTiA6 VirB7) [Vibrio fischeri ES114]
MNNITLLCLSLLLLSGCSSVSPHAQPSYQQAPIEVINDAQ
 
Nucleotide Sequence: 123 bp     [Download]
>gi|59714356|ref|NC_006842.1|:28724-28846 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGAACAACATCACCCTATTGTGTCTTAGCCTTTTATTATTAAGCGGCTGCTCTAGCGTCTCACCACACG
CTCAACCATCCTATCAACAAGCTCCGATTGAGGTGATTAATGATGCTCAATAA
 Primer design