SecReT4
Protein ID: 17233444
T4SS name [ID]Tra_F [105]
Gene symboltraL
Locus tagPSLT078
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]63013..63324 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDH9L485
KEGG IDstm:PSLT078
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.8e-38, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|17233444|ref|NP_490564.1| conjugal transfer pilus assembly protein TraL [Salmonella typhimurium LT2]
MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMTSKQLFGISAAVLVYFGIRKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|17233403|ref|NC_003277.1|:63013-63324 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGTCGGGAGACGAGAATAAACTCAGGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCGGTGGATGAATTAATTCCTGCTGCTGTCTGTATTGGCTGGGGATTAATGACATCAAAACA
ACTTTTCGGCATCAGCGCTGCGGTTCTGGTTTATTTCGGGATAAGAAAACTGAAAAAAGGGCGGGGAAGC
TCCTGGCTGCGTGACCTGATTTACTGGTATATGCCGACAGCCCTGCTTCGCGGTATTTTTCATAACGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAGTAA
 Primer design