SecReT4
Protein ID: 17233461
T4SS name [ID]Tra_F [105]
Gene symboltraF
Locus tagPSLT097
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]76687..77436 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ93GM5
KEGG IDstm:PSLT097
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3e-74, Aligned region: 25..239
Protein Sequence: 249 a.a.     [Download]
>gi|17233461|ref|NP_490581.1| conjugal pilus assembly protein TraF [Salmonella typhimurium LT2]
MRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKSAQVRQEPDIMQKLSALQTATKRALYE
AILYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIS
KLAEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFPA
MMLVDPKQGSVRPLSYGFITQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 750 bp     [Download]
>gi|17233403|ref|NC_003277.1|:76687-77436 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGCGAAAAATACAGACCGTATGGGTGGCAGCGTTACTCTGTGGCTCCCTGACGGCATACGGAAAAGATG
CCGGATGGCAGTGGTATAACGACCCGGTAAAATTACCTGACCCAAAAACGACGGATAAATCCGCTCAGGT
TCGTCAGGAGCCTGACATTATGCAGAAATTATCTGCGCTGCAGACCGCAACAAAGCGGGCGCTTTATGAA
GCCATTCTGTATCCCGGTGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACGCAGCAGG
CGGGGCTTTTCAGCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCTGAACTGGACTATAACCTGCAGTA
CAGCCACTACAACGGCACGGTACGTAACCAGCTGGCCGCAGACCAGGCTCAGCAACGGCAGGCCATATCA
AAGCTGGCTGAACACTACGGTATCATGTTCTTTTACCGCGGGCAGGACCCCATTGACGGCCAGCTGGCGC
AGGTGATTAATGGCTTTCGCGCCACTTACGGTCTGAGCGTTATCCCGGTGACCGTGGACGGGGTGATTAA
CCCGATGCTGCCGGATACGCGTCCTGACCAGGGGCAGGCGCAGCGTCTTGGTGTGAAATATTTCCCGGCC
ATGATGCTGGTAGACCCGAAACAGGGCAGTGTCCGTCCGTTGTCATACGGGTTTATTACGCAGGACGACC
TGGCAAAACAGTTCCTGAATGTGTCAGAAGATTTTAAGCCGAATTTCTAA
 Primer design