SecReT4
Protein ID: 17233462
T4SS name [ID]Tra_F [105]
Gene symboltraQ
Locus tagPSLT098
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]77650..77943 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ93GM4
KEGG IDstm:PSLT098
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.5e-49, Aligned region: 1..97
Protein Sequence: 97 a.a.     [Download]
>gi|17233462|ref|NP_490582.1| conjugal transfer pilin chaperone TraQ [Salmonella typhimurium LT2]
MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAELIAIILVLSGAYRVLDAWIARVSREE
RALLEARQAAILAAEKEEKGDKSHVSQ
 
Nucleotide Sequence: 294 bp     [Download]
>gi|17233403|ref|NC_003277.1|:77650-77943 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
GTGCGTAAATATAAATTATCGCTTCCTTTACCGGATATTACTGGAGTATGGGTTTTCTCCCTGGGCGTCT
GGTTTCACATTGTCGGGCGGCTGGTTTACCGCAAACCCTGGATGGCTTTTTTTCTGGCGGAACTGATTGC
CATCATTCTGGTGTTGTCCGGCGCTTACCGGGTGCTGGATGCCTGGATAGCCCGCGTCAGCCGGGAAGAG
CGTGCGTTACTGGAAGCCCGTCAGGCTGCCATTCTGGCTGCTGAAAAAGAAGAAAAGGGGGATAAATCAC
ATGTCTCTCAATAA
 Primer design