SecReT4
Protein ID: 17233471
T4SS name [ID]Tra_F [105]
Gene symboltraX
Locus tagPSLT110
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]92560..93300 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ93GL3
KEGG IDstm:PSLT110
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.3e-49, Aligned region: 30..245
Protein Sequence: 246 a.a.     [Download]
>gi|17233471|ref|NP_490593.1| conjugal transfer pilus acetylation protein TraX [Salmonella typhimurium LT2]
MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFLAGRGAFPLFA
LVWGLNLSQHTHIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAAL
LLLTAWIPLSGTSYGVAGVLVLVICYRLYRTTDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLT
VWLVSLTGKSRPRFWPADFFPVFYTCHLAALGVLAM
 
Nucleotide Sequence: 741 bp     [Download]
>gi|17233403|ref|NC_003277.1|:92560-93300 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGACGATGGATAACGCCACACGTAACGATTCGCGGGCAGTCCGGGTGGATACCCGGCTGCAGCGACTGC
TGGCCTGGTCGCCGGGACAGAGAGATCTCATCAAAACCGTGGCGCTGCTGCTGATGGTGGCTGACCATAT
TAACCGTATCCTGCACCTGAACCAAGAGTGGCTGTTTCTGGCCGGGCGCGGGGCGTTTCCGCTGTTTGCC
CTGGTGTGGGGGCTGAACCTGTCCCAGCATACGCATATCCGCCAGTCTGCGATTAACCGGCTGTGGGGAT
GGGCGGTTATCGCGCAGTCCGGATATTTTCTGGCGGGATTTCCGTGGTATGAAGGGAATATTCTGTTTGC
CTTTGCGGTGACCGCGCAGGCGCTGAAGTGGTGTGAGCAGCGCTGCCTGTTTCACTCTGCGGCCGCGCTG
TTACTGCTGACGGCGTGGATACCCCTGTCCGGAACCAGCTACGGCGTTGCCGGCGTGCTGGTGCTGGTCA
TCTGTTACCGGCTGTACCGGACCACAGATACTGAAGAACATCTGGCGCTTGCGGCCTGCCTAGTGGTGGC
CGTCCCCGCGCTGAATCTGGTCACCAGTGATGCCGCGGCGGTGGCAGGACTTCTGGTGACCGGGCTGACG
GTATGGCTTGTTTCGCTGACAGGCAAATCACGGCCCCGGTTCTGGCCGGCTGATTTTTTCCCGGTATTCT
ACACCTGCCATCTGGCTGCCCTGGGCGTTCTGGCGATGTGA
 Primer design