SecReT4
Protein ID: 17530588
T4SS name [ID]Trw [140]
Gene symboltraL
Locus tagR46_008
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]3160..3894 [+]
ProductTraL
Component typeTrwN
UniProt IDQ79SF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 6.7e-34, Aligned region: 31..176
Protein Sequence: 244 a.a.     [Download]
>gi|17530588|ref|NP_511186.1| TraL [Salmonella enterica subsp. enterica serovar Typhimurium]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGSIQLK
QQPRTEAEAVSVAKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKSY
PAGQVALRHALSCYNTGSLTNGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTANEPQQAKSTAPQ
YDGEQDVFGSGDGDAFSRNNTDAFLTRQETAKGE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|17530571|ref|NC_003292.1|:3160-3894 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGAGTAAACATCCAAAACTCCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCCGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACGATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGACCGTACAGGATCAATATTAACGGTAGTATTCAGTTAAAA
CAGCAACCGCGTACTGAAGCTGAGGCCGTCAGCGTTGCGAAAGTTCTGCTGAAGGATAATAAAAGTTTTG
ATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAA
ACCCTGCATCAACCTGCGGGCGAGCCAGACCATTCTTAAAGCCTGTTATGATAGCGCCCTGAAATCCTAC
CCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCACAAACGGGATTT
CTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCTGCT
ACCTGACGGCCAGACCAGTGAGGACAGCACCGCGAATGAGCCTCAGCAGGCAAAAAGTACGGCGCCGCAG
TATGACGGTGAACAAGATGTTTTTGGTTCTGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATGCCT
TTTTAACCAGACAGGAAACAGCGAAGGGGGAATGA
 Primer design