SecReT4
Protein ID: 17530590
T4SS name [ID]Trw [140]
Gene symboltraM
Locus tagR46_010
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]4194..4487 [+]
ProductTraM
Component typeTrwL
UniProt IDQ79SF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|17530590|ref|NP_511188.1| TraM [Salmonella enterica subsp. enterica serovar Typhimurium]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASYLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|17530571|ref|NC_003292.1|:4194-4487 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCTCTGATTGGTATTGGTTCTGCATCATATCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design