SecReT4
Protein ID: 17530591
T4SS name [ID]Trw [140]
Gene symboltraA
Locus tagR46_011
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]4537..4848 [+]
ProductTraA
Component typeTrwM
UniProt IDQ79SF0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 7.6e-22, Aligned region: 1..78
Protein Sequence: 103 a.a.     [Download]
>gi|17530591|ref|NP_511189.1| TraA [Salmonella enterica subsp. enterica serovar Typhimurium]
MFVDGKRPLFKGATRLPRALGVPRNVAMMIFMISASLFMIIHMWAILVFVFLRIPSAALTKYDDRMFRIM
GLWLKTNSVIGLILRLSSGEDRLIPLLTTNVRV
 
Nucleotide Sequence: 312 bp     [Download]
>gi|17530571|ref|NC_003292.1|:4537-4848 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGTTCGTTGACGGGAAAAGACCGCTTTTCAAAGGTGCGACTCGCTTACCTCGCGCGCTGGGTGTACCAC
GTAATGTAGCTATGATGATATTCATGATTTCTGCCTCGCTTTTTATGATTATTCATATGTGGGCGATCCT
GGTGTTCGTCTTTTTGCGGATTCCTTCAGCTGCATTAACAAAATATGACGACCGCATGTTTCGAATTATG
GGCCTGTGGTTGAAAACAAATTCAGTAATTGGTTTGATTCTCCGTTTAAGCAGTGGGGAGGATCGTCTTA
TTCCTCTGTTGACTACTAACGTAAGGGTTTAA
 Primer design