SecReT4
Protein ID: 17530592
T4SS name [ID]Trw [140]
Gene symboltraB
Locus tagR46_012
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]4853..7453 [+]
ProductTraB
Component typeTrwK
UniProt IDQ79SE9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.5e-62, Aligned region: 221..429
AAA_10 [PF12846], Evalue: 1.8e-33, Aligned region: 492..775
Protein Sequence: 866 a.a.     [Download]
>gi|17530592|ref|NP_511190.1| TraB [Salmonella enterica subsp. enterica serovar Typhimurium]
MRAATATKPKKIDAYRKEPSVNKKYLPYSYHLNDYVISMENGDLMAFFKLDGRTHDCASDRELVTWHKDL
NTLVKSFGTDHVELWTHEYHHEAKEYPDGEYDHFFPAYIDQYNRKLHGDSKQLINDLYLTVIYKQVGDKT
QKFLAKFEKPTRDEIQQMQNEALEGLEDISEQILEAMKPYRFSSWVSIIVTNAVLKFLRLIKKNVKNLLK
SMNQTFLTKPLLSNATSLNLRRLTLIQKRWSSFISSQIWNGPSCLFAVIVSVSTSWTTALLAPCGGDVVQ
IRTVDHNFYTTGIEFREYEEDTEPGQLNMLKEADFEYLLTQSFSCLSESSAKTFLTHQEKSLQETRDRAQ
SQLAQLGTALDMLTSREFVMGYHHGTVHVWDNDQNAVQAKARRVKVMLTGCGVVGGTLSLASEAAYYRRL
PGNQKWAPRPVPINSWNFLHFSPFHNFMRGKPDNNPWGPALTMFRTISGTPLYFNFHVTPLEELSYGKRP
LGHALITGMSGEGKTTLLNFLLAQSMKYNPRLFVYDRDRGMEPFIRSVGGYYKVLQQGMPSGFAPLQIEP
TKRNNALIKNLFRICVETTNNGPISATMATELAEGVDAVMGEGSLIPREARTVTILDGYVNEVVENGVSL
KGLLREWTREGQYGWLFDNDKDSLDLSANDIFGFDLSEFIAAKEEVSSPARTPLIVYLLYRVRDSIDGKR
RVIQCFDEFHAYLDDPVIEREVKRGIKTDRKKDAIYVFATQEPNDALSSRIGRTIMSQTVTKICLRDPEA
IREDYAFLTDAEYDALMSITEHSRQFLVKQGQQSAIASFNLYPRNSDDIDADIKTMDNVLSVLSGEPQNA
EIAHELVERLGNDPEVWLKEYWRLTA
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|17530571|ref|NC_003292.1|:4853-7453 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGAGAGCTGCCACCGCTACGAAGCCAAAAAAAATTGATGCCTACCGTAAGGAGCCATCAGTAAATAAAA
AGTATTTGCCCTATTCTTATCACCTCAATGATTACGTGATTTCGATGGAAAACGGCGATCTGATGGCTTT
TTTCAAGCTGGATGGCCGCACACATGACTGCGCATCAGATCGGGAACTGGTCACCTGGCATAAAGACCTT
AATACGCTGGTCAAGAGCTTCGGAACAGACCATGTAGAGCTGTGGACGCATGAATATCACCATGAGGCTA
AAGAGTACCCGGATGGTGAGTATGACCATTTTTTCCCTGCTTATATTGATCAATATAACCGTAAGTTGCA
CGGTGATTCCAAGCAGCTGATTAATGACCTTTATCTGACCGTTATTTACAAACAGGTAGGGGATAAAACA
CAGAAGTTTCTGGCGAAATTTGAAAAGCCGACTCGTGACGAAATTCAGCAAATGCAGAATGAGGCGCTTG
AAGGTCTGGAAGATATTTCTGAACAAATCCTGGAAGCAATGAAGCCGTATCGATTCAGCAGTTGGGTATC
TATTATCGTGACAAACGCGGTGTTGAAATTCCTGCGCCTGATAAAAAAGAACGTGAAGAACTTGCTGAAG
TCGATGAATCAGACATTTTTGACGAAGCCATTGTTATCGAACGCAACGAGCCTGAACCTTCGCAGGCTCA
CGCTTATTCAAAAGCGCTGGAGTTCCTTTATTTCCTCGCAAATATGGAATGGGCCATCGTGCCTGTTTGC
CGTGATCGTATCCGTGAGTACATCATGGACAACCGCCCTGTTAGCTCCCTGTGGGGGGGATGTTGTCCAG
ATCAGAACGGTAGATCACAACTTCTATACCACCGGCATTGAATTTCGTGAATACGAAGAAGATACAGAGC
CAGGCCAGCTTAACATGCTTAAAGAAGCCGATTTTGAATACCTTCTGACGCAGAGTTTTTCTTGCCTCTC
TGAATCTTCAGCTAAAACGTTTCTGACGCATCAGGAAAAATCTTTGCAGGAAACGCGCGACCGTGCGCAA
AGCCAGCTGGCACAGCTTGGTACCGCGCTCGATATGCTGACGTCCAGAGAGTTCGTGATGGGCTACCATC
ATGGAACCGTGCATGTCTGGGATAATGACCAAAACGCGGTACAGGCCAAAGCGCGTCGTGTGAAGGTTAT
GCTAACCGGCTGTGGCGTGGTTGGTGGGACTCTCAGCCTGGCCTCTGAGGCTGCATATTATCGGAGACTG
CCTGGCAACCAGAAATGGGCGCCGCGCCCGGTTCCGATAAACTCATGGAACTTCCTGCACTTCAGCCCGT
TCCACAATTTTATGCGTGGCAAGCCTGACAATAACCCGTGGGGGCCAGCGCTGACCATGTTCCGCACGAT
CAGCGGTACGCCACTCTATTTTAATTTCCATGTGACCCCGCTTGAAGAACTTTCCTACGGTAAACGCCCA
CTGGGCCATGCGTTAATAACGGGTATGTCGGGGGAAGGTAAAACCACGCTGCTTAACTTCCTGCTGGCGC
AGTCAATGAAGTACAACCCGCGACTTTTTGTTTATGACCGTGACCGCGGTATGGAGCCGTTCATTCGAAG
CGTTGGTGGCTACTATAAAGTTCTGCAACAGGGTATGCCGTCCGGGTTTGCCCCGCTTCAGATTGAACCG
ACCAAACGCAATAATGCCCTCATTAAAAACCTGTTCCGCATTTGTGTGGAAACCACCAATAACGGGCCTA
TCAGCGCAACGATGGCTACCGAACTGGCTGAAGGCGTTGATGCGGTTATGGGGGAAGGCTCACTTATTCC
ACGCGAGGCGCGCACCGTTACGATCCTGGACGGGTACGTGAATGAAGTTGTGGAAAATGGCGTATCACTG
AAAGGGCTGCTGCGCGAATGGACGCGCGAAGGCCAGTATGGCTGGCTGTTTGACAATGATAAAGACAGCC
TGGATCTCAGCGCGAATGATATTTTTGGCTTCGATTTATCCGAGTTTATCGCAGCCAAAGAGGAAGTATC
CAGCCCGGCCCGTACTCCGCTCATAGTGTACCTTCTGTACCGGGTACGTGACTCCATCGACGGCAAACGC
CGCGTCATTCAGTGCTTTGACGAGTTCCACGCCTACCTTGACGATCCGGTTATCGAGCGTGAAGTTAAGC
GTGGTATCAAAACTGACCGTAAGAAAGACGCTATCTATGTGTTTGCCACGCAGGAGCCGAACGATGCGCT
GTCCAGCCGTATTGGCCGCACGATCATGTCGCAGACCGTCACAAAAATCTGCCTGCGCGATCCGGAAGCT
ATCCGAGAGGATTATGCCTTCCTTACTGATGCTGAATACGACGCGCTGATGTCGATTACCGAACACTCCA
GACAGTTCCTGGTTAAACAAGGGCAACAGTCTGCGATTGCTTCTTTCAATCTCTACCCTCGCAACAGCGA
CGATATTGATGCAGATATTAAGACAATGGACAACGTACTTAGCGTGTTGTCCGGTGAACCACAAAACGCC
GAAATTGCGCATGAGCTGGTTGAACGGCTCGGTAATGACCCTGAAGTATGGCTCAAAGAATACTGGCGCC
TGACGGCTTAA
 Primer design