SecReT4
Protein ID: 17530593
T4SS name [ID]Trw [140]
Gene symboltraC
Locus tagR46_013
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]7471..8184 [+]
ProductTraC
Component typeTrwJ
UniProt IDQ79SE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.9e-43, Aligned region: 25..216
Protein Sequence: 237 a.a.     [Download]
>gi|17530593|ref|NP_511191.1| TraC [Salmonella enterica subsp. enterica serovar Typhimurium]
MKKSLTAVLLTTGLILGGAQRPSAGIIVSNPTELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTN
LGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMSPRQAIAYMKQKLDGKRC
LRPCDGRKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQATWNLMNMLQQSQDKL
LRAQKDRATRNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|17530571|ref|NC_003292.1|:7471-8184 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGAAAAAATCACTTACGGCAGTGCTGCTGACCACCGGCTTGATTCTTGGGGGCGCGCAAAGGCCCTCCG
CTGGCATCATCGTATCCAACCCCACCGAGCTGATTAAACAGGGTGAACAGCTTGAACAAATGGCTCAACA
GCTGGAGCAGCTTAAAAGCCAGCTGGAGACGCAGAAAAATATGTATGAGTCGATGGCTAAAACAACCAAC
CTGGGCGATCTGCTGGGGACGTCAACCAATACGCTGGCGAATAACCTGCCAGACAACTGGAAAGAGGTGT
ACAGCGACGCGATGAACTCCAGTTCGTCGGTCACGCCTTCTGTTAACAGCATGATGGGCCAGTTTAATGC
TGAGGTTGACGACATGAGCCCCAGGCAAGCAATCGCCTATATGAAACAAAAGCTGGACGGAAAAAGGTGC
TTACGACCGTGTGATGGCCGAAAAGCCTACAACAACCAGATGCAAGAGCTGAGCGATATGCAGGCGCTGA
CGGAGCAGATTAAATCGACGCCAGACCTGAAATCCATTGCCGACCTGCAAGCACGTATCCAGACGTCACA
AGGCGCTATACAGGGTGAGCAGGCGACATGGAATTTGATGAATATGTTACAGCAATCGCAGGACAAACTT
TTGCGCGCACAGAAGGATCGTGCGACCCGTAATTTTGTTTTTGGAACCGGTGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design