SecReT4
Protein ID: 17530595
T4SS name [ID]Trw [140]
Gene symboltraD
Locus tagR46_015
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]8435..9475 [+]
ProductTraD
Component typeTrwI
UniProt IDQ79SE6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.5e-50, Aligned region: 40..268
Protein Sequence: 346 a.a.     [Download]
>gi|17530595|ref|NP_511193.1| TraD [Salmonella enterica subsp. enterica serovar Typhimurium]
MAFTLVQDIFAKVDGAITSMVSANVATIISDVTPLVATCLTIKLMMQGLYSMFNPGAGDSLSSLIKEYLS
IALILSFATAGGWFQQDLVNVALHMPDDFAGILSSPDKVEASGVPAIIDSGIEKGVRIVNTAWDAADVFS
SSGLAAYAIGGIMLVATVVLGGLGAGFVIMAKILLAVTLCFGPIAIFCLLWGLIKNIFARWLGSVINYGL
VVVVLALVFGFIMQMFDNLLSSMNSDAAYSSITGSMAALLLTIISIFVLFQIPQVAQSWGSGISAGVADA
ARSTGSSMQALGNMGSHGMFGGNAFRGGNTGGGQQSAGGGSGSNSGGSSGSNLSGKARGSRGKKAA
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|17530571|ref|NC_003292.1|:8435-9475 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGGCATTCACCCTGGTACAAGACATTTTCGCAAAAGTAGACGGGGCGATTACGTCAATGGTGAGCGCCA
ACGTTGCCACCATTATCTCTGACGTTACGCCTCTGGTGGCAACCTGCCTGACCATAAAGCTGATGATGCA
GGGCTTGTACTCGATGTTTAATCCGGGGGCAGGCGACAGCCTAAGCTCGCTGATTAAAGAGTATCTATCT
ATAGCCCTTATCCTGAGCTTTGCGACGGCAGGCGGCTGGTTTCAGCAGGATTTGGTTAATGTGGCGCTTC
ACATGCCAGATGATTTTGCTGGCATCTTATCTTCCCCTGATAAAGTCGAAGCCAGCGGCGTACCGGCGAT
CATTGATAGCGGTATTGAAAAAGGCGTCAGGATTGTAAATACAGCGTGGGATGCGGCAGATGTATTTTCG
TCAAGCGGTCTGGCCGCATATGCCATTGGCGGAATTATGTTGGTTGCTACCGTTGTGCTGGGTGGCCTCG
GTGCGGGCTTTGTGATCATGGCGAAAATCCTTCTTGCCGTTACGCTTTGTTTCGGCCCGATTGCCATTTT
CTGCCTGCTGTGGGGGTTAATAAAAAACATCTTCGCGCGCTGGCTTGGATCGGTAATCAACTACGGGCTG
GTCGTTGTCGTGCTGGCTCTCGTGTTTGGTTTCATCATGCAGATGTTCGACAACCTTCTGTCCTCGATGA
ACTCCGATGCGGCCTATTCATCTATCACTGGCTCTATGGCCGCGCTGCTGCTGACCATTATCTCTATCTT
TGTTCTGTTTCAGATCCCGCAGGTCGCCCAGAGCTGGGGTAGCGGTATCAGTGCCGGTGTCGCAGATGCT
GCACGTTCTACCGGTTCTTCAATGCAGGCGCTTGGCAACATGGGTAGTCATGGCATGTTTGGCGGTAATG
CGTTCCGGGGCGGTAATACCGGCGGCGGCCAGCAATCGGCAGGTGGAGGAAGTGGCAGCAACAGCGGAGG
AAGCAGTGGTTCTAATTTAAGTGGTAAGGCAAGGGGCAGTCGCGGGAAGAAGGCTGCATAA
 Primer design