SecReT4
Protein ID: 17530596
T4SS name [ID]Trw [140]
Gene symboltraN
Locus tagR46_016
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]9558..9704 [+]
ProductTraN
Component typeTrwH
UniProt IDQ79SE5
KEGG IDNA
PDB ID2OFQ
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|17530596|ref|NP_511194.1| TraN [Salmonella enterica subsp. enterica serovar Typhimurium]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGRNES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|17530571|ref|NC_003292.1|:9558-9704 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTCGAAATGA
AAGCTAA
 Primer design