SecReT4
Protein ID: 17530597
T4SS name [ID]Trw [140]
Gene symboltraE
Locus tagR46_017
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]9694..10392 [+]
ProductTraE
Component typeTrwG
UniProt IDQ79SE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-51, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|17530597|ref|NP_511195.1| TraE [Salmonella enterica subsp. enterica serovar Typhimurium]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVALMSTPNVAESYQSK
FKGRNGLDKVLGDSETARVKINSVILDKPHGVRTIRFTTVRRVRTNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|17530571|ref|NC_003292.1|:9694-10392 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTAGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGCGTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAATGGTCTTGATAAGGTTCTGGGCGACAGTGAAACAGCCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTACGAACAATACGCTTTACTACGGTTCGCCGCGTGCGCACGAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCGGAAGTTAACTGA
 Primer design