SecReT4
Protein ID: 17530600
T4SS name [ID]Trw [140]
Gene symboltraG
Locus tagR46_020
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]12486..13481 [+]
ProductTraG
Component typeTrwD
UniProt IDQ79SE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-49, Aligned region: 10..311
AAA_22 [PF13401], Evalue: 3.2e-05, Aligned region: 156..189
Protein Sequence: 331 a.a.     [Download]
>gi|17530600|ref|NP_511198.1| TraG [Salmonella enterica subsp. enterica serovar Typhimurium]
MTDAAFYQLGPLREYLEDPTVFEIRINCFQEVICDTFSGRRVVQNAAITADFIRNLAKSLVSSNKLTMQA
INDVILPGGIRGVICLPPAVIDGTTAVAFRKDLAADKNLEQLTSEGIFSDCRKITGSKQSLTDDDFFLKE
LHSSEKWPAFLQTAVEKKRTIVICGETGSGKTVLTRALLKSLHKDERVIILEDVHEVTVDHVVEAVYMMY
GDAGKIGPVSATDALRACMRLTPGRIIMTELRDDAAWDYLKALNTGHPGGVMSTHANSARDAFNRIGLLI
KATPIGRMLDMSDIMRMLYSTIDVVVHMEKRKIKEIYFDPEYKMQCVNGSL
 
Nucleotide Sequence: 996 bp     [Download]
>gi|17530571|ref|NC_003292.1|:12486-13481 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGACTGATGCAGCTTTCTATCAACTTGGCCCACTGCGCGAGTATTTAGAAGATCCTACTGTTTTTGAAA
TTCGCATTAACTGCTTTCAGGAAGTTATCTGTGATACGTTCAGCGGCCGCAGGGTTGTGCAGAACGCGGC
AATTACGGCAGATTTTATTAGGAACCTTGCTAAATCGTTGGTGAGCAGCAACAAGCTGACCATGCAGGCC
ATTAATGACGTGATCCTGCCTGGCGGGATCAGGGGCGTTATCTGTCTGCCCCCTGCGGTGATTGACGGTA
CAACGGCCGTAGCGTTTCGTAAGGATTTGGCGGCCGATAAAAATCTGGAGCAGCTGACCAGCGAGGGGAT
TTTCAGTGACTGCCGGAAGATTACCGGCAGCAAGCAAAGCCTAACGGATGATGATTTTTTCCTTAAAGAG
CTGCACAGCAGCGAAAAATGGCCCGCATTCCTGCAAACCGCCGTTGAGAAGAAACGCACTATCGTGATCT
GCGGTGAAACCGGGTCGGGGAAAACGGTACTCACGCGCGCGCTGTTAAAATCGCTACATAAAGACGAGCG
TGTAATTATTTTAGAGGACGTTCACGAAGTCACGGTCGATCACGTTGTAGAAGCCGTTTATATGATGTAC
GGCGATGCAGGAAAGATCGGCCCGGTCAGCGCCACTGATGCCCTGCGAGCCTGTATGCGTCTGACACCGG
GCCGTATCATCATGACTGAGCTTAGGGATGATGCTGCGTGGGATTATCTTAAAGCACTTAATACCGGCCA
TCCAGGCGGTGTTATGTCAACGCACGCTAACTCTGCGCGCGATGCCTTTAACCGTATTGGGCTGCTTATC
AAGGCGACCCCTATCGGCCGTATGCTCGATATGAGCGATATTATGCGAATGCTCTACTCCACCATTGACG
TTGTGGTGCATATGGAAAAGCGGAAAATCAAAGAAATTTATTTTGACCCTGAATATAAAATGCAGTGTGT
GAACGGGAGCCTGTAA
 Primer design