SecReT4
Protein ID: 17530604
T4SS name [ID]Trw [140]
Gene symboltraJ
Locus tagR46_024
StrainIncN plasmid R46
Repliconplasmid R46 [GenBank: NC_003292] [Browse all T4SS(s) in this replicon]
Location [Strand]18046..19575 [-]
ProductTraJ
Component typeTrwB
UniProt IDQ79SD7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.4e-116, Aligned region: 112..490
TraG-D_C [PF12696], Evalue: 1.5e-19, Aligned region: 350..471
T4SS-DNA_transf [PF02534], Evalue: 7.4e-10, Aligned region: 313..472
DUF87 [PF01935], Evalue: 1.5e-05, Aligned region: 116..170
Protein Sequence: 509 a.a.     [Download]
>gi|17530604|ref|NP_511202.1| TraJ [Salmonella enterica subsp. enterica serovar Typhimurium]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELREI
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|17530571|ref|NC_003292.1|:c19575-18046 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R46, complete sequence
ATGGACGATAGAGAAAGAGGCTTAGCATTTTTATTTGCAATTACTTTGCCTCCAGTGATGGTATGGTTTC
TAGTTGCAAAATTTACCTACGGTATTGATCCATCCACGGCTAAATACCTGATTCCGTATCTGGTTAAGAA
TACTTTTTCGCTATGGCCTTTATGGTCAGCTTTAATTGCAGGCTGGTTTATTGGTGTTGGCGGTCTGATC
GCTTTTATCATTTATGATAAATCACGCGTGTTTAAAGGCGAAAGATTCAAAAAGATTTATCGTGGTACAG
AGCTTGTTCGCGCCAGAACACTCGCTGATAAAACACGCGAAAGAGGTGTCAACCAGTTAACCGTGGCTAA
TATCCCCATACCTACATACGCTGAGAACTTGCATTTTTCGATTGCCGGTACAACCGGTACTGGTAAAACC
ACAATTTTCAATGAACTGTTATTTAAGAGCATCATTAGAGGCGGCAAAAATATTGCTTTAGATCCAAATG
GGGGGTTCTTAAAGAATTTCTATCGTCCCGGCGATGTTATTTTAAACGCCTATGATAAACGCACTGAAGG
CTGGGTGTTTTTCAATGAAATTCGCCGTTCATATGATTACGAGCGCTTAGTGAACTCTATTGTTCAGGAA
AGCCCTGATATGGCTACTGAAGAATGGTTCGGCTATGGCCGTCTTATTTTTAGTGAAGTTTCGAAAAAAC
TTCACAGCCTATACAGCACAGTAACTATGGAAGAAGTTATTCACTGGGCCTGTAACGTTGACCAGAAAAA
ATTAAAAGAATTTTTAATGGGGACGCCTGCCGAAGCTATTTTTTCCGGGTCTGAAAAAGCAGTTGGAAGC
GCGCGATTTGTTCTCAGTAAGAATCTTGCCCCACATTTGAAAATGCCGGAAGGTAATTTTTCCCTGCGTG
ACTGGCTTGATGATGGAAAGCCGGGAACCCTGTTTATCACCTGGCAGGAAGAAATGAAAAGGTCACTTAA
TCCGCTAATTTCCTGCTGGCTGGATTCGATTTTTTCTATCGTGCTGGGTATGGGTGAAAAAGAAAGCCGC
ATTAATGTATTTATTGACGAGCTGGAATCACTCCAGTTTCTGCCAAACCTCAACGATGCACTGACCAAAG
GGCGTAAAAGCGGTCTGTGTGTTTATGCTGGCTATCAAACCTATTCTCAGCTGGTTAAGGTTTATGGTCG
GGATATGGCTCAGACCATTCTGGCTAACATGCGTTCTAACATCGTGCTGGGCGGCAGCCGTCTCGGTGAT
GAAACGTTGGATCAAATGTCGCGCTCACTCGGTGAGATAGAAGGCGAAGTTGAGCGTAAAGAATCCGATC
CTCAGAAGCCCTGGATTGTCCGTAAACGCCGCGACGTTAAAGTTGTTCGTGCCGTAACGCCTACCGAAAT
ATCAATGTTGCCAAACCTCACCGGCTATCTGGCGTTGCCTGGTGATATGCCCGTCGCTAAGTTCAAGGCT
AAACACGTTAAATACCATCGCAAAAACCCTGTTCCTGGCATTGAACTGAGGGAGATCTGA
 Primer design