SecReT4
Protein ID: 17547294
T4SS name [ID]Trb [300]
Gene symboltrbI
Locus tagRSc2575
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2781912..2783189 [-]
Productconjugal transfer TrbI transmembrane protein
Component typeTrbI
UniProt IDQ8XWA0
KEGG IDrso:RSc2575
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.7e-59, Aligned region: 229..411
Protein Sequence: 425 a.a.     [Download]
>gi|17547294|ref|NP_520696.1| trbI gene product [Ralstonia solanacearum GMI1000]
MSQDDTPDLAAPQAGKVAPEAVALRAQPRPVTRLNRRTLAILAGTLSVAVLGALMWSLQPQRRGAGEQTE
LYNVERVSKSEGLDALPADYSKLPPPLPASVPELGPPLPGDLGPAIVKSHQPMTAAYAAPGHDPNDALRK
EAEAAAASSVFFRLGSQAAPVAQTQVAAAPDFAANAAFDRLAAGPASTAAQPADPTAVQNLQDQKEAFQK
AGNTETRNSGNLTLPASPYQVMAGTVVAGALVTGIKSDLPGDVIATVTEPVYDTATGRFLLIPQGSRILG
KYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLAGTDPAGYAGLEDDVDYHWGRIFAGAALTTLLGVGAE
LAAPENRQDGNRIVIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPLFFN
RGTSR
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2783189-2781912 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAGCCAGGACGACACTCCCGACCTTGCCGCGCCGCAGGCGGGCAAGGTAGCGCCCGAGGCGGTGGCGC
TTCGCGCCCAGCCGCGCCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCATCCTCGCAGGTACCCTGTC
GGTCGCCGTGCTTGGCGCGCTGATGTGGTCACTGCAACCGCAGCGGCGCGGCGCAGGCGAGCAGACCGAG
CTTTACAACGTCGAACGCGTCTCGAAGTCAGAAGGGCTGGACGCGCTGCCGGCGGACTACTCGAAGTTGC
CGCCCCCTTTGCCGGCATCCGTGCCGGAGCTGGGGCCGCCGCTGCCTGGCGATCTTGGACCGGCCATCGT
GAAGTCGCATCAGCCGATGACGGCCGCCTATGCGGCCCCCGGCCACGACCCCAACGATGCGCTGCGCAAG
GAAGCCGAAGCGGCGGCGGCATCGTCGGTGTTCTTCCGCTTAGGGTCGCAGGCCGCGCCGGTGGCGCAGA
CGCAGGTGGCCGCCGCGCCGGACTTCGCCGCTAATGCGGCGTTCGACCGACTCGCGGCTGGCCCGGCCTC
GACGGCCGCCCAGCCTGCCGACCCGACCGCCGTACAGAACCTGCAAGACCAGAAAGAGGCTTTCCAGAAA
GCCGGAAACACGGAAACCCGTAATTCCGGCAATCTGACCCTGCCGGCTTCGCCGTATCAGGTCATGGCCG
GAACGGTGGTCGCAGGTGCCTTGGTGACGGGCATCAAGTCGGACTTGCCGGGCGACGTGATCGCCACGGT
GACGGAGCCGGTCTATGACACGGCCACCGGGCGCTTCCTGCTGATTCCGCAGGGTTCGCGCATCCTGGGC
AAATACAACAGCCAGGTCAGCTACGGGCAGAGCCGCGTGCAGGTGGTGTGGAACCGGATCATCCTGCCGG
ATACGTCTTCGCTCACACTCGACAACCTGGCCGGCACCGACCCTGCCGGCTATGCCGGGCTGGAAGACGA
CGTGGACTACCACTGGGGCCGCATCTTCGCCGGGGCGGCGTTGACGACGCTGCTGGGTGTCGGTGCCGAG
CTGGCCGCGCCGGAGAACCGACAGGACGGCAACCGCATCGTCATCGCCGGGCGCGACAGCGCGCAGGACA
GCATCAATCAGGTCGGTCAGGAGATGACCCGGCGCAACATGAACATCCAGCCGACGCTGACCGAACGGCC
GGGCCTGCCGGTTCGCATCATCGTCAACCGCGATCTGGTGCTGCGGCCCTACCAGCCGCTTTTCTTCAAC
AGGGGGACTTCACGATGA
 Primer design