SecReT4
Protein ID: 17547295
T4SS name [ID]Trb [300]
Gene symboltrbG
Locus tagRSc2576
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2783192..2784196 [-]
Productconjugal transfer lipoprotein TrbG
Component typeTrbG
UniProt IDQ8XW99
KEGG IDrso:RSc2576
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-66, Aligned region: 107..326
Protein Sequence: 334 a.a.     [Download]
>gi|17547295|ref|NP_520697.1| trbG gene product [Ralstonia solanacearum GMI1000]
MNLSFRFYALPSILLASTVLFSGCASQGKPPPSISLDEPVQAQPLPEPPAPVEVVAVPEPLALPAQLKQL
PEVDTAPAEPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYAAPGRVTVVSLQPGEEL
VTVAAGDTVRWIVGDTSSGSGDALRVNVLVKPIRSGLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYP
KDRMLALQRQSQAASAAAPVDTGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGITQGELPPL
FVIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGVARRN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2784196-2783192 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAACCTGTCTTTCCGCTTTTACGCTTTGCCGTCGATCCTGCTGGCATCGACTGTCCTGTTCTCGGGCT
GCGCCTCGCAGGGCAAGCCGCCACCGTCCATTTCGCTCGATGAGCCGGTGCAGGCGCAGCCGCTACCGGA
GCCGCCCGCGCCGGTGGAAGTGGTCGCCGTGCCTGAACCCCTGGCGCTGCCTGCGCAGTTGAAGCAACTG
CCCGAGGTGGACACGGCCCCGGCCGAGCCGGAGCCGGCCGACGAGAAGGTGCGCGTGTCCCGCGCCAATG
CCGAGGCGCGCATTGCGCCGACCCGCGAGGGTTACGTCAATGCGATTCAGGTGTGGCCCTTCACCGATGG
CGCGCTCTATCAGGTCTATGCCGCGCCGGGGCGCGTGACCGTGGTTTCGCTCCAGCCCGGCGAGGAACTT
GTCACTGTCGCGGCTGGCGACACGGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCAGCGGCGACGCGC
TGCGCGTCAATGTGCTGGTCAAGCCTATCCGCTCGGGCCTCAAAACCAATCTGGTCATCACCACCAGCCG
CCGGACGTACCTGCTGGAGCTGACCTCGACGGAAAAGGCGTGGATGGCTTCGGTGTCCTGGGACTATCCG
AAAGACCGGATGCTGGCCTTGCAGCGCCAGTCACAGGCGGCCAGCGCCGCCGCGCCAGTCGATACCGGCT
TGTCGCTGGAGAAGATCCGCTTCCGCTACGCGGTCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGC
CTTCGATGACGGCGAGAAGGTCTATATCCAGTTCCCGCCGGGCATCACCCAAGGCGAGTTGCCGCCCTTG
TTCGTAATCGGTGCGCAGGGCGACGGGCAACTGGTGAACTACCGTTTCCGCTCGCCGTACTACATCGTAG
ATCGGCTGTTCGGCGCGGCCGAACTGCGCCTGGGTGGCGACAAGGGCGACGTGGTGCGGATCGAGCGCAC
CGATGGCGTTGCACGGAGGAACTGA
 Primer design