SecReT4
Protein ID: 17547296
T4SS name [ID]Trb [300]
Gene symboltrbF
Locus tagRSc2577
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2784193..2784897 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ8XW98
KEGG IDrso:RSc2577
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.3e-62, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|17547296|ref|NP_520698.1| trbF gene product [Ralstonia solanacearum GMI1000]
MRFKRPQVRYADTPQPATPYQSAAQVWDDRIGSARVQAKNWRFMAFGCLTLVLLMAGGLVWRSAQSIVTP
YVIEVDQSGQVRAVGEAATPYRPADAQIAHHLARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAAVLND
YASKNDPFARIGKESVTVQITSVVRASDTSFNVRWTEQRFVNGAPAGTERWNAVLSTVLQTPRTEQRLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2784897-2784193 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGCGATTCAAACGCCCGCAGGTGCGCTATGCCGATACGCCGCAACCCGCCACTCCGTACCAATCCGCCG
CGCAGGTGTGGGACGACCGCATCGGCTCGGCCCGCGTCCAGGCCAAGAACTGGCGATTCATGGCTTTCGG
CTGCCTCACGCTTGTGCTGCTGATGGCTGGCGGCCTGGTGTGGCGTTCGGCGCAATCCATCGTCACGCCC
TATGTCATCGAGGTCGATCAGTCCGGGCAGGTGCGCGCCGTCGGCGAAGCCGCCACGCCGTACCGGCCCG
CCGATGCGCAGATCGCGCACCATCTGGCGCGCTTCGTGACGCTGGTGCGCTCGCTGTCCATCGACCCCAT
CGTGGTGCGGCAGAACTGGCTGGATGCCTACGACTACACCACCGACAAGGGCGCGGCGGTGCTCAACGAT
TACGCCAGCAAGAACGACCCCTTCGCTCGCATCGGCAAGGAGTCGGTGACGGTTCAGATCACCAGCGTTG
TCCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACAGAGCAGCGCTTCGTCAACGGCGCACCCGCTGG
CACCGAACGCTGGAACGCCGTGCTTTCCACTGTCCTGCAAACCCCGCGCACCGAACAGCGCCTGCGCAAG
AACCCGCTGGGTATCTATGTCAACGGCCTGTCGTGGAGCCGCGAATTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design