SecReT4
Protein ID: 17547297
T4SS name [ID]Trb [300]
Gene symboltrbL
Locus tagRSc2578
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2784928..2786301 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ8XW97
KEGG IDrso:RSc2578
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.7e-49, Aligned region: 37..264
Protein Sequence: 457 a.a.     [Download]
>gi|17547297|ref|NP_520699.1| trbL gene product [Ralstonia solanacearum GMI1000]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIAIDMTIAGLYWAMSHATGQSEDVIAKLLRKVLY
VGAFAYIIGNFNWLSGIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAAAPILDQIGDMAGFPEVF
VNLDPIVVLFIAWLVVILCFFVLAVQLFITLIEFKLTTLAGFVLIPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPDEPSIDHALVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAVGTGVAIGAAATGVGGAVMAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGGGAKGAAAG
LGNVAKTGAQAAGRRAASRVSAAGQKMAGSFRAGWNGADAGAAGSDQAAAGESADSAASAPKQEQPAWAK
QMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRPDE
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2786301-2784928 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAATGACGTGACCATCATCGACAGATTCCTCGATACGTTCTCGCGCTATATCGACTCCGGTTTCGGGC
TATTGCAAGGCGAAGTCGCGTTCCTGACGGCCACGCTTATCGCCATCGACATGACCATCGCCGGCCTGTA
TTGGGCCATGAGCCATGCGACCGGCCAGAGCGAAGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTCTCGGGCATCGTGTTCCGGTCGTTTGCTG
GGCTAGGTATCACCGCCACCGGCTCCGCTATCACGATGGAGAACTTCTTGCAGCCGGGCCGCCTGGCGAA
GACCGGCATCGACGCGGCCGCGCCGATCCTCGACCAGATCGGCGACATGGCCGGCTTCCCCGAAGTGTTC
GTGAACCTTGACCCCATCGTGGTGCTGTTCATCGCCTGGCTGGTGGTGATCCTCTGCTTCTTCGTGCTCG
CGGTACAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTTGCCGGGTTCGTCCTGATCCCGTT
TGCGCTCTGGAACAAGACCTCGTTCCTCGCGGAAAAGGTGCTCGGCAACGTGGTTTCGTCGGGCATCAAG
GTCTTGGTGCTGGCCGTCATCGTCGGCATCGGCTCGGGCCTGTTCGCGGAGTTCCAGGTTCATCCCGACG
AGCCTTCCATCGACCACGCGCTGGTCGTGATGCTGGCCTCGCTCGCGCTGCTGGCGCTGGGCATCTTCGG
CCCCGGCATCGCCACGGGCCTCGTGTCCGGTGCGCCGCAGCTCGGCGCGGGCGCGATGGCCGGCGCTGCT
GTCGGTGCTGTCGGCACGGGAGTTGCCATCGGTGCCGCCGCGACTGGCGTAGGCGGTGCCGTTATGGCGG
GCGCGCGCATGGCCCCGGCCGCCGCCAAGCTGGCCGGCAGCGGCGCACGCGCCGCGACGTCGGCGGCCAG
CAGCGCCAAGTCCGCATTCCAGGCCGGTTCCGCCGCTGCGGGCGGCGGGGCCAAGGGCGCGGCCGCTGGC
CTCGGCAACGTCGCCAAGACCGGTGCGCAGGCCGCAGGCCGCCGCGCCGCATCGCGTGTGTCCGCTGCCG
GGCAGAAGATGGCCGGTTCCTTCCGTGCTGGCTGGAACGGCGCGGATGCCGGCGCTGCCGGTTCCGACCA
GGCGGCCGCAGGCGAAAGCGCGGACAGCGCCGCCAGCGCACCAAAGCAGGAGCAACCCGCCTGGGCCAAG
CAGATGCACCGCCGCCAACAGATCACCCACGCCGCGACCACCGCTGCCCACACGCTGCGCGGTGGCGATG
GTGGCGGCTCGGGGCAAGGCCCGAGCCTGCGCCCCGATGAGTGA
 Primer design