SecReT4
Protein ID: 17547299
T4SS name [ID]Trb [300]
Gene symboltrbJ
Locus tagRSc2580
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2786637..2787374 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ8XW95
KEGG IDrso:RSc2580
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|17547299|ref|NP_520701.1| trbJ gene product [Ralstonia solanacearum GMI1000]
MKTRVLSVSLAAVLSVSLLAVQPASALTVFDPSNFVQNTLTAVRTLEQINNQINQLQNEAQMLMNQARNL
TKLDFNIVNRLRSTLATTERLIAEAQGLAYDVQSMDATFSRLYPEQYAATISGDQMLRDAQERWKNTLNG
LHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAMQATNQLLALQAKQSIQAQQLQITQDRAASLE
LARQAAATERAREVRRRFLGTGTPYTPQSVNFYNN
 
Nucleotide Sequence: 738 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2787374-2786637 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAAGACCCGTGTGCTTTCCGTTTCGCTCGCCGCCGTGCTGTCGGTGTCGCTGCTGGCCGTGCAGCCCG
CATCGGCGCTGACGGTGTTCGACCCGTCCAACTTCGTGCAGAACACGCTGACCGCCGTTCGCACGCTGGA
GCAGATCAACAACCAGATCAATCAGCTCCAAAACGAAGCGCAGATGCTGATGAACCAGGCGCGCAACCTG
ACGAAGCTGGACTTCAACATCGTCAACCGGCTGCGCTCGACGCTCGCCACGACCGAACGCCTGATCGCCG
AGGCGCAAGGGCTGGCCTATGACGTGCAGAGCATGGATGCCACGTTCTCGCGCCTGTACCCGGAGCAGTA
CGCCGCCACCATCAGCGGCGACCAGATGCTGCGCGATGCGCAGGAACGCTGGAAAAACACGCTGAACGGC
CTGCACACCGCGATGCGGATGCAGGCGCAGGTTTCCCAGAACCTGGCGCAAGACGAAAGCGCGCTGGCCG
ACCTCGTGAGCCAGAGTCAATCGGCCACCGGCGCGCTGCAAGCCATGCAGGCCACCAATCAACTGCTGGC
GCTCCAGGCCAAACAGTCGATTCAGGCCCAGCAGCTCCAGATCACGCAAGACCGGGCGGCCTCGCTGGAA
CTGGCGCGGCAGGCGGCGGCCACCGAGCGCGCCCGCGAAGTGCGGCGGCGCTTCCTGGGCACCGGCACGC
CGTACACGCCGCAGTCCGTCAATTTCTACAACAACTGA
 Primer design