SecReT4
Protein ID: 17547300
T4SS name [ID]Trb [300]
Gene symboltrbE
Locus tagRSc2581
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2787371..2789821 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ8XW94
KEGG IDrso:RSc2581
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.5e-36, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 5.8e-16, Aligned region: 294..388
TraG-D_C [PF12696], Evalue: 1.2e-05, Aligned region: 654..707
DUF87 [PF01935], Evalue: 6.4e-05, Aligned region: 443..478
Protein Sequence: 816 a.a.     [Download]
>gi|17547300|ref|NP_520702.1| trbE gene product [Ralstonia solanacearum GMI1000]
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATTARLNNALRRLG
SGWALFIEAERRPAADYPYSDFPEPLSWLVDEERRAAFEESGNHFESTYHLTLAYLPPEESRARAAKLLY
EHAPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDDAATLTYLHATISTRRYRVGVPEVPFHLDAL
LADSALVGGLAPMLGDQHLRVVSVRGFPTSTWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDASNKAADADAALQELGSDQVAFGYLTATVTVLDADPAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPERNKHLDGPP
VIVTRTDGATPFRLVTHIGDVGHMAVVGPTGMGKSAFLAVLAMQFRRYLHSRIFVFDMGRSMRATILGLG
GEHYDLGADGGIAFQPLAHIDAEGYRTWAAEWVEGRLLHEGVTVGPDEKAGIWSALGSLAGAPVEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADRDRLGSADVQCFEMEELMASPAAVRSVLGYLFARFDERF
DGSPTLLILDESWLFLDDPVFAARIRQWLKTLRKRNVSVVFATQSLADIQNSSIAAAIIESCAVRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKQDYYYQSRLGNRLFDLDLGPVVLAFAGASTPQDQRDIER
VLTQAGAPGFAGAWLRHRGLDWAADLLPSSPAAASVLATQPLEVSP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2789821-2787371 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCCAGCGGCCCGCCTTGCTGGCCGACTGGCTTCCTTGGGCCGGGCTGA
TCGCACCGGGTGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACAGCCCGTTTCCGTGGTCCCGATCT
CGATAGCGCCACGCAAGGCGAGTTGATCGCCACCACGGCGCGGCTGAACAACGCGCTGCGCCGGCTGGGT
TCGGGCTGGGCGCTGTTCATCGAGGCCGAGCGCCGACCGGCCGCAGACTACCCGTATTCCGACTTCCCCG
AACCACTGTCCTGGCTCGTGGACGAGGAACGCCGCGCCGCCTTCGAGGAATCGGGCAACCACTTCGAGAG
CACCTATCACCTGACGCTGGCCTACCTGCCGCCGGAGGAATCCCGCGCCCGTGCGGCCAAGCTGCTGTAC
GAGCACGCGCCGGGCGATGGCGTGGACTGGCGCGGTCGGCTCGATGCCTTCGTGGCGGAAACCGATCGCG
TCTTTGACCTGCTCGATGGCGTGATGCCGGAAATCGCCTGGCTGGACGATGCTGCGACGCTGACCTATCT
GCACGCGACCATCTCGACGCGGCGCTACCGCGTGGGCGTGCCGGAAGTGCCGTTTCACCTCGACGCGCTG
CTGGCCGATTCCGCCCTGGTCGGCGGCCTCGCGCCCATGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGGGGCTTCCCGACATCGACCTGGCCGGGCCTGCTGGACGACCTCAACCGCCTGGGCTTTGCCTATCG
CTGGTCAACCCGGTTCCTCTGCCTCGACAAAGCGGAGGCGGAAAAGGAGCTGGGCCGCCTGCGCCGCCAA
TGGTTTGCCAAGCGCAAGAATGTCATCGCGCTGCTGCGCGAAACGATCTTTCAGCAGGAATCGCCCTTGG
TGGACACGGATGCCAGCAACAAGGCGGCCGACGCCGACGCTGCGTTGCAGGAGCTGGGCAGCGATCAAGT
GGCCTTCGGCTACCTCACCGCCACGGTGACGGTACTTGATGCTGATCCAGCCGTGGCCGACGAAAAGCTG
CGCATGGTGGAGCGCGTGATTCAGGGCCGCGGCTTTGTAACCATCCCCGAAACGCTCAATGCCGTGGATG
CGTGGCTGTCGTCCATCCCTGGCAACGCCTATGCCAATGTGCGCCAGCCCATCGTCTCGACGTTGAACCT
GGCGCACATGATGCCGCTGTCGGCGGTGTGGGCCGGCCCGGAGCGCAACAAGCACTTGGACGGCCCGCCG
GTGATTGTCACGCGCACTGACGGCGCAACGCCGTTTCGCTTGGTCACGCACATCGGCGACGTGGGCCACA
TGGCCGTGGTCGGCCCGACCGGCATGGGCAAGTCGGCCTTCCTGGCCGTGCTAGCGATGCAATTCCGGCG
CTATCTGCACTCGCGCATCTTCGTCTTCGACATGGGCCGCTCCATGCGCGCCACCATCCTGGGCCTGGGA
GGCGAGCACTACGACCTCGGCGCGGATGGCGGCATTGCCTTTCAGCCACTCGCGCACATCGACGCAGAGG
GCTACCGCACCTGGGCCGCCGAATGGGTGGAAGGCCGGCTGCTGCACGAAGGCGTCACCGTCGGCCCGGA
CGAGAAGGCCGGCATCTGGTCGGCGCTCGGCAGTCTGGCCGGTGCGCCCGTGGAGCAGCGCACGATGACC
GGGCTTTCGGTGCTGCTGCAATCGAACGCGCTGCGCCAGGCACTCGCGCCCTATGTGCTCGGCGGCGCAC
ACGGCAAGCTGCTGGATGCAGACCGCGACCGGCTCGGCAGCGCGGACGTTCAGTGCTTCGAGATGGAGGA
ACTGATGGCCAGCCCCGCCGCCGTGCGGTCGGTGCTGGGCTACCTGTTTGCCCGCTTCGATGAACGATTC
GACGGTTCGCCCACGCTGCTGATCCTCGATGAATCCTGGCTGTTCCTGGATGACCCGGTATTTGCCGCAC
GCATCCGCCAGTGGTTGAAGACGCTGCGCAAGCGCAATGTCAGTGTCGTCTTCGCTACGCAAAGCCTGGC
GGATATTCAGAACTCCAGCATCGCGGCGGCCATCATCGAAAGCTGCGCGGTTCGGATTTTCTTGCCCAAC
CCGCAGGCGACCGAACCGCAGATTCGCACGATCTACGAGGGCTTCGGCCTCAACAGCCGGCAAATCGAGA
TCGTCGCCACCGCGCAACCCAAGCAGGACTACTACTACCAATCGCGCCTCGGCAATCGCCTGTTCGACCT
CGACCTGGGGCCGGTCGTGCTCGCCTTCGCAGGCGCATCCACACCGCAAGACCAACGCGACATAGAGCGC
GTGCTGACGCAGGCCGGCGCTCCCGGCTTCGCCGGCGCGTGGCTGCGCCATCGCGGCCTCGATTGGGCCG
CCGACCTGCTGCCGTCCTCGCCGGCGGCAGCTTCTGTCCTTGCTACTCAACCGCTGGAGGTTTCGCCATG
A
 Primer design