SecReT4
Protein ID: 17547301
T4SS name [ID]Trb [300]
Gene symboltrbD
Locus tagRSc2582
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2789834..2790106 [-]
Productconjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDQ8XW93
KEGG IDrso:RSc2582
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.5e-11, Aligned region: 4..85
Protein Sequence: 90 a.a.     [Download]
>gi|17547301|ref|NP_520703.1| trbD gene product [Ralstonia solanacearum GMI1000]
MSGPDSFAAGFEVPLHRSLTEPILMGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSMAVWGARV
DPQFMQVFARHIKHKSLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2790106-2789834 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAGCGGGCCGGACAGCTTCGCGGCCGGCTTCGAGGTGCCGCTACATCGCTCGCTCACCGAGCCGATCC
TCATGGGCGGCGCACCGCGCACCGTGGCAATTGCCAACGGTACGCTGGCCGCCGCCGTCGGGCTGGGCCT
GCAACTCTGGATTCCCGGTGTCGTGCTCTGGATCGTCGGTCACTCGATGGCCGTGTGGGGCGCGCGTGTT
GATCCGCAGTTCATGCAGGTCTTCGCCCGGCACATCAAGCACAAGTCGCTGCTGGACGTATAG
 Primer design