SecReT4
Protein ID: 17547302
T4SS name [ID]Trb [300]
Gene symboltrbC
Locus tagRSc2583
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2790103..2790495 [-]
Productconjugal transfer TrbC transmembrane protein
Component typeTrbC
UniProt IDQ8XW92
KEGG IDrso:RSc2583
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-23, Aligned region: 34..120
Protein Sequence: 130 a.a.     [Download]
>gi|17547302|ref|NP_520704.1| trbC gene product [Ralstonia solanacearum GMI1000]
MTQMHVPAFRFSVNPIPRVSSLAWLRSLARPAGQGLLLAALLLFIAGTAQAAGSSMPWEGPLQSILESIQ
GPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 393 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2790495-2790103 Ralstonia solanacearum GMI1000 chromosome, complete genome
GTGACGCAGATGCACGTTCCTGCTTTCCGCTTTTCCGTAAATCCGATTCCCCGCGTATCCAGCCTCGCGT
GGCTGCGCAGCCTGGCCCGCCCGGCGGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCATCGCCGG
AACTGCGCAGGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATTCTGGAGTCGATCCAG
GGGCCGGTGGCGCGCATCGTCGCGGTCATCATCATCATCGCCACGGGCCTGGCGCTGGCGTTTGGCGACA
CATCGGGCGGCTTCCGCAAGCTGATCCAGATTGTGTTCGGCCTGTCCATCGCGTTCGCGGCTTCGAGCTT
CTTCCTGTCGTTCTTCAGCTTCTCCGGCGGGGCGGTTGTATGA
 Primer design