SecReT4
Protein ID: 17547303
T4SS name [ID]Trb [300]
Gene symboltrbB
Locus tagRSc2584
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2790492..2791559 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDQ8XW91
KEGG IDrso:RSc2584
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.8e-81, Aligned region: 32..298
TrwB_AAD_bind [PF10412], Evalue: 1.9e-06, Aligned region: 154..191
FtsK_SpoIIIE [PF01580], Evalue: 1.9e-06, Aligned region: 151..223
AAA_16 [PF13191], Evalue: 9e-05, Aligned region: 147..188
Protein Sequence: 355 a.a.     [Download]
>gi|17547303|ref|NP_520705.1| trbB gene product [Ralstonia solanacearum GMI1000]
MSAVPQTPPERSSTAASLDRRIQMLRTAMGPVIAAALADPDVVEIMLNPDRTLWVDRLSSGRTPLGVELP
EADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAVSIIGLDRYVSDGI
LTTGQADFLRRAVRERQNILIAGATSSGKTTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTRA
GVVSMTELVRATMRLRPDRVIVGEVRGGEALDLVKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVN
PPRALIAEAVNVVIHIAGRGRKRRVESIARVVGFDGVGYRLADALETPFPELTPVPLAANAAAPSPSLDQ
PGELP
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2791559-2790492 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGAGCGCCGTTCCGCAAACCCCGCCCGAACGATCTTCCACCGCGGCTTCGCTGGATCGCCGCATCCAGA
TGCTGCGCACGGCTATGGGGCCGGTCATCGCCGCTGCGCTGGCCGACCCGGACGTGGTGGAAATCATGCT
CAACCCCGACCGCACCCTATGGGTGGATCGGCTGTCCTCGGGCCGCACGCCGCTGGGCGTCGAACTGCCC
GAGGCCGATGGCGAACGCATCATCCGCCTGGTCGCCGCCCATGTCGGTGCGGAGGTGCATCGCGGCCAAC
CGCTCTTGACCGCCGAGCTGCCGGAAACCGGCGAACGCTTCGAGGGCATCTTGCCGCCGGCTGCACCGGG
GCCGGCCTTCGCGCTGCGCAAGCGCGCCGTGAGCATCATTGGCCTGGATCGCTACGTCAGCGACGGCATC
CTGACCACCGGGCAGGCGGACTTCCTGCGCCGCGCCGTGCGCGAGCGCCAGAACATCCTGATCGCCGGGG
CAACGAGCAGCGGCAAGACCACGCTCGCCAATGCCTTGCTTGCGGAAATCGCCGCCACGGGCGACCGCGT
GCTGGTGCTCGAAGACACCATCGAGCTGCAATGCGCCGCCCGCGACCATGTGCCGCTGCGCACCCGCGCC
GGCGTCGTGTCCATGACCGAGTTGGTGCGCGCCACGATGCGTCTGCGCCCCGACCGCGTGATCGTCGGCG
AGGTGCGCGGCGGCGAAGCCCTGGACTTGGTGAAGGTGTGGGGCACTGGCCATCCCGGCGGCATCGCCAC
CATCCACGCCGGTTCCGCGCTGGGTGCGCTGCTGCGCCTGGAACAGTTGATTCTTGAAGTGGCGGTGAAT
CCGCCGCGTGCGCTGATCGCCGAGGCGGTCAACGTCGTGATCCACATCGCCGGACGCGGCCGCAAGCGCC
GCGTCGAAAGCATCGCCCGCGTCGTCGGCTTCGACGGTGTGGGCTACCGCCTGGCGGACGCGCTGGAAAC
GCCGTTTCCCGAGCTGACGCCGGTTCCTCTTGCAGCCAATGCCGCTGCGCCTTCCCCGTCCCTTGACCAA
CCTGGAGAACTGCCGTGA
 Primer design