SecReT4
Protein ID: 17547305
T4SS name [ID]Trb [300]
Gene symboltraG
Locus tagRSc2586
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2792029..2794056 [-]
Productconjugal transfer protein TraG
Component typeTraG
UniProt IDQ8XW89
KEGG IDrso:RSc2586
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.7e-103, Aligned region: 112..560
TrwB_AAD_bind [PF10412], Evalue: 2.5e-31, Aligned region: 172..539
TraG-D_C [PF12696], Evalue: 6.7e-31, Aligned region: 404..524
Protein Sequence: 675 a.a.     [Download]
>gi|17547305|ref|NP_520707.1| traG gene product [Ralstonia solanacearum GMI1000]
MQAQGVLFGQIAAVFGIVIAGVWSATQWTAAALGYQLRLGSPWFDFFGTPVYHPWRLFEWWFFFDAYAPH
VFDIGGAIAGGSGLVAVAVTIAMSVWRSRQSRMVTTYGSARWAEADDIRKAGLTQPAGVFLGKYRNEYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDARSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTKHLGDAPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIASEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIARRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFSTNDERTAKRVSETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPTDEAVVMVSSVAPIKAKKLRYYADANFKSRVLPPPA
LAAGPINGRYADAPPARPDDWSGLAIPAVPAAPAASQSSDGAGTADDGGPRRQPELSEVAEYSPEPQPAC
NDLALLDDDDDLPLPYAASLPGQLDPAMQRTARLASLDPNDGIDL
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2794056-2792029 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGCAAGCTCAGGGCGTGCTGTTCGGGCAGATCGCCGCCGTCTTCGGCATCGTGATCGCCGGTGTGTGGA
GTGCAACGCAATGGACAGCCGCCGCCCTGGGCTACCAACTACGCCTTGGCTCGCCGTGGTTCGATTTCTT
CGGCACGCCGGTCTATCACCCCTGGCGGCTGTTCGAGTGGTGGTTCTTCTTCGATGCCTACGCGCCGCAC
GTCTTCGACATAGGTGGCGCGATTGCAGGCGGCAGCGGCCTGGTGGCCGTGGCCGTGACCATCGCCATGT
CGGTGTGGCGCTCGCGGCAATCGCGCATGGTCACGACCTACGGTTCGGCGCGCTGGGCCGAAGCGGATGA
CATCCGCAAAGCCGGGCTGACGCAGCCGGCCGGCGTCTTCCTAGGCAAGTATCGCAACGAGTATCTGCGC
CATGAAGGCCCGGAACACGTCCTGACTTTCGCGCCCACTCGCTCGGGCAAGGGTGTCGGCTTGGTCGTCC
CGACATTGCTGTCCTGGCCGGCTTCGGCCGTCATCCATGACATCAAAGGCGAGAACTGGCAGATCACCGC
AGGTTGGCGCAGCCGGTTCAGCCACTGCCTGCTGTTCAACCCGACCGATGCGAGGTCAGCGGCCTACAAC
CCGCTCCTGGAGGTACGGCGCGGCGCGCATGAGGTGCGCGATGTGCAGAACATCGCGGACATTCTCGTTG
ACCCCGAGGGCGCGCTGGAGAAGCGCAACCATTGGGAGAAGACTTCGCACGCGCTGCTGGTCGGCGCGAT
CCTGCATGTACTCTATGCCGGCGAGGACAAGACGCTGCGCGGCGTCGCCAACTTCCTGTCCGACCCGGCC
AGCCCGTTCGAGCTGACCTTGCATCGGATGATGACGACGAAGCACCTGGGCGATGCACCGCACCCGGTTG
TCGCGTCCGCCGCCCGCGAAGTGCTCAACAAATCGGACAACGAACGCTCGGGCGTGTTGAGCACCGCCAT
GTCGTTCCTCGGCCTGTACCGCGACCCGACCGTGGCGGAAGTGACTTCGCGCTGCGACTGGCGCATCGCC
GACCTGATCGCATCCGAGCATCCGGTGTCCCTCTATTTGGTGGTGCCGCCATCGGACATTTCGCGGACGA
AGCCGCTCATCCGCCTGATCCTCAACCAGATCGGCCGGCGGCTCACCGAATCTCTCGACGGCAGCGATGG
CATCGCGCGCCGCCACAAGCTGCTGCTGATGCTGGACGAGTTCCCGGCGCTGGGCCGGCTCGACTTCTTC
GAGACGGCGCTGGCCTTCATGGCCGGCTACGGCATCCGCAGCTTCCTCATCGCGCAGTCGCTCAACCAGA
TCGACAAAGCCTACGGCCAGAACCACTCCATCCTCGACAACTGCCACGTCCGCGTGACGTTTTCGACGAA
CGACGAACGCACGGCCAAACGGGTTTCGGAAACGCTGGGCACCGCCACCGAACTGCGCGCCCAGCGCAAC
TATGCCGGGCACAGATTGGCCCCCTGGCTGGGGCACCTCATGGTGTCGCGCCAGGAGACGGCCCGTCCGC
TGCTGACGCCCGGCGAAGTCATGCAGCTTCCGACCGACGAAGCCGTGGTGATGGTGTCCAGCGTGGCACC
GATCAAGGCCAAGAAGCTGCGCTACTACGCCGACGCCAACTTCAAGAGCCGCGTATTGCCGCCGCCCGCG
CTCGCGGCCGGGCCAATCAATGGACGTTATGCCGACGCGCCACCGGCCCGGCCCGACGACTGGAGCGGCC
TGGCGATCCCCGCTGTACCAGCGGCCCCGGCTGCGAGCCAGTCCAGCGATGGCGCAGGCACCGCCGATGA
CGGCGGCCCGCGCCGCCAGCCCGAGCTATCCGAAGTCGCCGAATACAGCCCCGAGCCGCAGCCCGCATGC
AACGACCTGGCGCTGCTCGATGACGACGACGACCTGCCGCTGCCTTACGCGGCCTCTCTCCCCGGCCAGC
TCGACCCGGCCATGCAGCGCACGGCCCGGCTGGCTTCCCTCGACCCTAACGACGGAATCGACCTATGA
 Primer design