SecReT4
Protein ID: 17547321
T4SS name [ID]Trb [300]
Gene symboltraF
Locus tagRSc2602
StrainRalstonia solanacearum GMI1000
Repliconchromosome [GenBank: NC_003295] [Browse all T4SS(s) in this replicon]
Location [Strand]2806866..2807465 [-]
Productconjugal transfer TraF transmembrane protein
Component typeTraF
UniProt IDQ8XW73
KEGG IDrso:RSc2602
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1e-52, Aligned region: 50..194
Protein Sequence: 199 a.a.     [Download]
>gi|17547321|ref|NP_520723.1| traF gene product [Ralstonia solanacearum GMI1000]
MTAPTTTVNAPAVAPRLRSRLRACIVVATLTAIGFAALAWAAFVSPLPRLTYNPSDSVAVGWYRIDPFDS
RTASLPRPLSVDSIVLVPLPATAATLAAQRGYLPTHIPLLKRVGAVAPQHVCIVAGQVRIDGVPSAAVLP
ADRLGRPLPSLQLCRRLEPGELYLLSVTNPASFDSRYFGPVSASAVIGIARPIWLETRP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|17544719|ref|NC_003295.1|:c2807465-2806866 Ralstonia solanacearum GMI1000 chromosome, complete genome
ATGACCGCCCCGACCACTACGGTAAACGCACCTGCCGTTGCGCCGCGTCTTCGCTCGCGCCTGCGCGCTT
GCATCGTCGTGGCGACACTGACCGCCATCGGCTTCGCTGCGCTGGCCTGGGCGGCTTTCGTGTCGCCGCT
GCCGCGTCTGACCTACAACCCGTCCGACAGCGTAGCGGTCGGCTGGTATCGCATCGACCCGTTCGACTCG
CGCACCGCCTCGCTGCCACGTCCCTTGTCGGTGGACAGCATCGTGCTGGTGCCGCTGCCGGCCACGGCTG
CCACGCTGGCTGCGCAGCGTGGCTATCTGCCGACGCACATTCCGCTACTCAAACGTGTGGGTGCGGTGGC
GCCGCAACACGTCTGCATCGTCGCCGGTCAGGTACGCATCGACGGCGTGCCCTCGGCCGCCGTGCTGCCT
GCTGATCGGCTGGGCCGGCCGCTGCCGTCCTTACAGCTTTGCCGCCGCCTTGAACCGGGCGAACTGTACC
TGTTGAGCGTGACCAATCCGGCATCGTTCGACAGCCGCTACTTCGGCCCGGTCAGCGCATCCGCCGTGAT
CGGCATTGCGCGCCCGATCTGGCTGGAGACACGCCCATGA
 Primer design