SecReT4
Protein ID: 17988375
T4SS name [ID]VirB [1]
Gene symbol-
Locus tagBMEII0031
StrainBrucella melitensis bv. 1 str. 16M
Repliconchromosome II [GenBank: NC_003318] [Browse all T4SS(s) in this replicon]
Location [Strand]31302..31475 [+]
ProductVirB7
Component typeVirB7
UniProt IDD0B5R5, P0C537
KEGG IDbme:BMEII0031
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|17988375|ref|NP_541008.1| VirB7 [Brucella melitensis bv. 1 str. 16M]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|17988344|ref|NC_003318.1|:31302-31475 Brucella melitensis bv. 1 str. 16M chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design