SecReT4
Protein ID: 17988379
T4SS name [ID]VirB [1]
Gene symbol-
Locus tagBMEII0035
StrainBrucella melitensis bv. 1 str. 16M
Repliconchromosome II [GenBank: NC_003318] [Browse all T4SS(s) in this replicon]
Location [Strand]34187..35272 [+]
ProductATPase VIRB11-like protein
Component typeVirB11
UniProt IDQ8YDY9
KEGG IDbme:BMEII0035
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-66, Aligned region: 25..327
Protein Sequence: 361 a.a.     [Download]
>gi|17988379|ref|NP_541012.1| ATPase VIRB11-like protein [Brucella melitensis bv. 1 str. 16M]
MSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLI
SLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHV
RPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDV
PELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGSI
TSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKR
ALSLQHSEKAQ
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|17988344|ref|NC_003318.1|:34187-35272 Brucella melitensis bv. 1 str. 16M chromosome II, complete sequence
ATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCTGTCAAACGGGCGGCCTCGGTCAATTTCC
ATCTGGAACCGCTGCGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGGCGA
AGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTGATT
TCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTGCGA
TCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGTGAC
GATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACACGTC
AGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATTACA
TGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGGCAA
GACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGACGTA
CCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAGAAG
AAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCTGCT
TGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGCATC
ACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACCGCC
AGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCACGT
CCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAACGG
GCACTGTCACTGCAACACAGTGAGAAGGCGCAATGA
 Primer design