SecReT4
Protein ID: 18150977
T4SS name [ID]VirB [383]
Gene symboltraB
Locus tagpWWO_p125
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]96954..98504 [+]
Productputative traB protein
Component typeVirD4
UniProt IDQ8VMG2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2e-123, Aligned region: 125..498
TraG-D_C [PF12696], Evalue: 6.3e-18, Aligned region: 363..479
T4SS-DNA_transf [PF02534], Evalue: 1.4e-16, Aligned region: 288..500
AAA_10 [PF12846], Evalue: 6.4e-11, Aligned region: 139..442
Protein Sequence: 516 a.a.     [Download]
>gi|18150977|ref|NP_542914.1| putative traB protein [Pseudomonas putida]
MHKQEVDSAAMTAGFGLPIAGWLAGTQLAQLPLAPFPAAFKETLHNGWQEPMVLGMTIAASVAAAGLCYY
LYEYCDDGFRGERFQQWLRGSRIRNWHFVERKVSARNAKTNRERRKKGQEKAEPIMIGKLPMPLHLEDRN
TMICASIGAGKSVTMEGMIASALRRNDRMAVVDPNGTFYSKFSFKGDYILNPFDARSAGWTIFNEIRGVH
DFNRMAKSIIPPQVDPSDEQWCAYARDVLSDTMRKLMETGNANQDTLVNLLVREDGDTIRAFLANTDSEG
YFRDNAEKAIASIQFMMNKYIRPLRYMGKGDFSIYRWVNDPDAGNLFITWREDMRDTMRPLVATWIDTIC
ATILSSEPMTGKRLWLFLDELQSLGKLESFVPAATKGRKHGLRMVGSLQDWSQLNASYGRDDAETLLSCF
RNYVILAAANAKNADMAKEILGNHEVKRFRKSWTAGRMTRAEEIKLEPVVMDSEISNLNDLEAYVKFAED
FPITKIKTPYVDYKERAPAIVIGQAA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|18150858|ref|NC_003350.1|:96954-98504 Pseudomonas putida plasmid pWW0, complete sequence
ATGCACAAACAAGAGGTTGATTCAGCCGCCATGACGGCGGGCTTTGGTTTACCGATCGCTGGCTGGTTGG
CCGGCACACAATTGGCCCAGCTGCCGCTGGCTCCTTTCCCGGCAGCATTCAAAGAGACTCTGCACAACGG
TTGGCAGGAACCGATGGTGCTGGGCATGACCATCGCTGCGTCCGTCGCGGCTGCTGGGCTCTGTTACTAC
CTGTACGAGTATTGCGACGACGGGTTCCGAGGTGAACGTTTCCAGCAATGGCTGCGTGGCTCGCGGATCC
GCAACTGGCATTTCGTGGAGCGAAAAGTAAGTGCCCGTAATGCCAAGACTAACCGTGAACGCCGCAAAAA
AGGGCAGGAAAAGGCCGAGCCAATCATGATCGGCAAGCTGCCGATGCCTCTGCACTTGGAAGACCGCAAC
ACCATGATCTGTGCATCCATCGGCGCCGGTAAGTCCGTGACGATGGAAGGCATGATCGCCTCGGCACTCC
GGCGCAACGACCGCATGGCAGTGGTCGACCCGAACGGTACGTTTTACTCGAAATTCAGTTTCAAAGGCGA
TTACATCCTCAATCCATTTGACGCTCGCTCCGCAGGATGGACGATCTTCAACGAGATCCGTGGCGTCCAC
GATTTCAACAGGATGGCCAAGTCGATTATTCCGCCACAGGTGGACCCCAGCGATGAGCAGTGGTGTGCGT
ACGCAAGGGACGTGCTGTCCGACACCATGCGCAAGCTGATGGAGACAGGCAACGCCAACCAGGACACGCT
GGTGAACCTGCTGGTTCGTGAAGACGGCGACACTATCCGTGCATTCCTGGCCAACACCGACTCCGAAGGC
TACTTCCGCGACAACGCGGAAAAGGCCATCGCCAGCATCCAGTTCATGATGAACAAGTACATCCGACCCC
TGCGCTACATGGGCAAAGGCGATTTTTCCATCTATCGCTGGGTGAACGATCCCGACGCCGGCAACCTGTT
TATCACTTGGCGGGAAGACATGCGCGACACCATGCGCCCACTGGTGGCCACCTGGATCGACACCATCTGC
GCAACCATCCTCAGCTCTGAACCGATGACAGGTAAGCGTCTCTGGCTGTTCCTCGATGAACTGCAGTCGC
TGGGCAAGTTGGAAAGCTTTGTGCCTGCAGCGACCAAGGGGCGGAAACACGGCCTGCGCATGGTCGGCAG
CCTGCAGGACTGGTCGCAGCTCAACGCCAGCTATGGCCGCGACGATGCCGAAACCCTGCTTTCGTGCTTC
CGTAACTACGTCATCCTGGCAGCGGCAAACGCCAAGAACGCCGATATGGCCAAGGAGATCTTGGGCAACC
ATGAGGTCAAGCGCTTCCGTAAGTCGTGGACCGCAGGGCGCATGACGCGGGCCGAGGAAATCAAGCTTGA
ACCGGTCGTGATGGATTCGGAGATCTCGAACCTCAATGACCTGGAAGCCTACGTCAAGTTTGCCGAGGAC
TTCCCCATCACCAAGATCAAAACGCCTTACGTCGATTACAAGGAACGGGCGCCGGCAATCGTCATTGGCC
AAGCTGCTTGA
 Primer design